Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SAP3

Protein Details
Accession Q7SAP3    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-172GASKECSKCKHTRCKQCPRIPSKKTHydrophilic
218-241TQDLVHKKPRQRVRRTCCGCKNLFHydrophilic
NLS Segment(s)
PositionSequence
40-44RTKRL
48-64GAKADPAAPAEKKGKEA
178-184ESRKKRA
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
KEGG ncr:NCU07997  -  
Amino Acid Sequences MIKNNAIVMSSATQGGPAAVPKEEKKGFGKVLARVKTVLRTKRLSTSGAKADPAAPAEKKGKEAAKSTTKTAPAAAAAAAAAKTVDANAQKVPRAQLFEERAKKLGELYGLELKPSEWHSTEGHALRVEKPIKMRVHRKCHQCDTSFGASKECSKCKHTRCKQCPRIPSKKTEAEREESRKKRAQIIKDRAENAPIVPDWHPKREKDLVLRRPAKTGTQDLVHKKPRQRVRRTCCGCKNLFTSGNKTCTACQHVRCTDCPRDPSKKDKYPYGYPGDQPSKRQAYFECKACKNTFASEPTVTTCPKCFNRNTERLAPKRVEPQPDPEAWKSIQAKLAAMNLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.11
5 0.12
6 0.13
7 0.17
8 0.19
9 0.28
10 0.3
11 0.33
12 0.35
13 0.4
14 0.41
15 0.44
16 0.48
17 0.47
18 0.54
19 0.54
20 0.52
21 0.47
22 0.47
23 0.48
24 0.51
25 0.51
26 0.49
27 0.5
28 0.51
29 0.57
30 0.58
31 0.54
32 0.51
33 0.5
34 0.51
35 0.48
36 0.45
37 0.38
38 0.37
39 0.34
40 0.31
41 0.28
42 0.21
43 0.24
44 0.29
45 0.29
46 0.3
47 0.34
48 0.37
49 0.36
50 0.4
51 0.43
52 0.47
53 0.48
54 0.5
55 0.5
56 0.47
57 0.43
58 0.39
59 0.32
60 0.23
61 0.21
62 0.17
63 0.11
64 0.09
65 0.09
66 0.07
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.08
73 0.08
74 0.1
75 0.14
76 0.17
77 0.19
78 0.21
79 0.24
80 0.23
81 0.26
82 0.26
83 0.3
84 0.34
85 0.41
86 0.46
87 0.45
88 0.44
89 0.41
90 0.39
91 0.32
92 0.28
93 0.21
94 0.15
95 0.17
96 0.23
97 0.22
98 0.22
99 0.21
100 0.19
101 0.19
102 0.2
103 0.2
104 0.13
105 0.16
106 0.16
107 0.19
108 0.24
109 0.23
110 0.22
111 0.21
112 0.21
113 0.2
114 0.27
115 0.26
116 0.23
117 0.24
118 0.3
119 0.34
120 0.4
121 0.48
122 0.51
123 0.59
124 0.64
125 0.71
126 0.72
127 0.75
128 0.74
129 0.66
130 0.59
131 0.56
132 0.56
133 0.51
134 0.43
135 0.36
136 0.3
137 0.34
138 0.36
139 0.32
140 0.28
141 0.3
142 0.38
143 0.45
144 0.55
145 0.59
146 0.66
147 0.73
148 0.81
149 0.86
150 0.85
151 0.86
152 0.84
153 0.86
154 0.78
155 0.74
156 0.7
157 0.68
158 0.64
159 0.62
160 0.56
161 0.51
162 0.54
163 0.56
164 0.58
165 0.54
166 0.57
167 0.54
168 0.53
169 0.56
170 0.56
171 0.58
172 0.59
173 0.64
174 0.66
175 0.65
176 0.66
177 0.57
178 0.52
179 0.42
180 0.31
181 0.24
182 0.16
183 0.13
184 0.12
185 0.2
186 0.21
187 0.28
188 0.32
189 0.3
190 0.36
191 0.4
192 0.43
193 0.45
194 0.53
195 0.54
196 0.61
197 0.67
198 0.61
199 0.58
200 0.56
201 0.49
202 0.43
203 0.39
204 0.31
205 0.29
206 0.34
207 0.37
208 0.44
209 0.48
210 0.5
211 0.52
212 0.58
213 0.64
214 0.68
215 0.73
216 0.75
217 0.76
218 0.81
219 0.83
220 0.85
221 0.84
222 0.81
223 0.73
224 0.67
225 0.62
226 0.58
227 0.56
228 0.49
229 0.47
230 0.45
231 0.46
232 0.42
233 0.4
234 0.35
235 0.33
236 0.38
237 0.37
238 0.36
239 0.41
240 0.45
241 0.48
242 0.51
243 0.53
244 0.54
245 0.54
246 0.56
247 0.55
248 0.59
249 0.6
250 0.65
251 0.68
252 0.68
253 0.67
254 0.7
255 0.69
256 0.67
257 0.7
258 0.68
259 0.62
260 0.56
261 0.61
262 0.62
263 0.57
264 0.53
265 0.55
266 0.55
267 0.51
268 0.51
269 0.46
270 0.46
271 0.5
272 0.55
273 0.55
274 0.51
275 0.57
276 0.56
277 0.55
278 0.49
279 0.47
280 0.45
281 0.4
282 0.41
283 0.36
284 0.35
285 0.35
286 0.36
287 0.33
288 0.29
289 0.28
290 0.31
291 0.35
292 0.4
293 0.43
294 0.49
295 0.57
296 0.64
297 0.69
298 0.71
299 0.75
300 0.74
301 0.76
302 0.69
303 0.64
304 0.65
305 0.65
306 0.63
307 0.56
308 0.58
309 0.57
310 0.59
311 0.61
312 0.54
313 0.52
314 0.44
315 0.5
316 0.45
317 0.43
318 0.42
319 0.37
320 0.35
321 0.33