Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YLH2

Protein Details
Accession A0A2P7YLH2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
175-202IPWVLQKKTAKKSKKEKRQNNDTEEQKEHydrophilic
NLS Segment(s)
PositionSequence
181-192KKTAKKSKKEKR
Subcellular Location(s) cyto 12, nucl 10, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043527  C:tRNA methyltransferase complex  
GO:0016300  F:tRNA (uracil) methyltransferase activity  
GO:0006448  P:regulation of translational elongation  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSVPSIPLETQEVPEEQEQQYVHEVYNEIASHFSLTRYKPWPIVEKFLLEQPDYSLGLDVGCGNGKYLGVNKKLFCIGLDRSDGLVECARVNSENKFNLAVADGLHLPHQNDRFDFAILIAVIHHFANEKRRIEAIEHILSKLRVGGRLLVYCWALEQEKSRRGYKEGDDQDILIPWVLQKKTAKKSKKEKRQNNDTEEQKEEEQPETKYRYYHLYRKGELVENAEKAGGKVVDHGYEKDNWWVIMERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.21
4 0.24
5 0.22
6 0.21
7 0.25
8 0.23
9 0.21
10 0.19
11 0.19
12 0.15
13 0.2
14 0.18
15 0.14
16 0.14
17 0.14
18 0.14
19 0.14
20 0.16
21 0.17
22 0.18
23 0.25
24 0.29
25 0.32
26 0.34
27 0.38
28 0.46
29 0.44
30 0.5
31 0.45
32 0.44
33 0.42
34 0.42
35 0.39
36 0.3
37 0.27
38 0.21
39 0.22
40 0.19
41 0.18
42 0.14
43 0.11
44 0.1
45 0.1
46 0.08
47 0.06
48 0.07
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.13
55 0.19
56 0.23
57 0.27
58 0.27
59 0.29
60 0.3
61 0.3
62 0.24
63 0.23
64 0.2
65 0.19
66 0.21
67 0.2
68 0.19
69 0.19
70 0.18
71 0.15
72 0.14
73 0.11
74 0.09
75 0.09
76 0.09
77 0.1
78 0.12
79 0.13
80 0.17
81 0.18
82 0.18
83 0.19
84 0.18
85 0.17
86 0.16
87 0.13
88 0.08
89 0.08
90 0.07
91 0.07
92 0.08
93 0.08
94 0.08
95 0.12
96 0.14
97 0.14
98 0.14
99 0.16
100 0.16
101 0.16
102 0.15
103 0.11
104 0.1
105 0.08
106 0.08
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.13
115 0.19
116 0.2
117 0.2
118 0.21
119 0.22
120 0.23
121 0.26
122 0.25
123 0.24
124 0.24
125 0.23
126 0.24
127 0.22
128 0.21
129 0.19
130 0.14
131 0.11
132 0.11
133 0.14
134 0.14
135 0.15
136 0.16
137 0.15
138 0.14
139 0.12
140 0.12
141 0.1
142 0.09
143 0.09
144 0.14
145 0.19
146 0.25
147 0.29
148 0.33
149 0.33
150 0.35
151 0.39
152 0.38
153 0.41
154 0.39
155 0.4
156 0.37
157 0.36
158 0.33
159 0.29
160 0.25
161 0.15
162 0.11
163 0.08
164 0.13
165 0.13
166 0.17
167 0.22
168 0.31
169 0.4
170 0.5
171 0.58
172 0.62
173 0.73
174 0.8
175 0.85
176 0.88
177 0.89
178 0.9
179 0.92
180 0.92
181 0.89
182 0.87
183 0.83
184 0.76
185 0.69
186 0.62
187 0.53
188 0.47
189 0.41
190 0.35
191 0.32
192 0.29
193 0.32
194 0.34
195 0.33
196 0.31
197 0.31
198 0.36
199 0.4
200 0.46
201 0.5
202 0.53
203 0.53
204 0.57
205 0.6
206 0.56
207 0.51
208 0.5
209 0.45
210 0.38
211 0.36
212 0.33
213 0.28
214 0.22
215 0.24
216 0.18
217 0.13
218 0.16
219 0.18
220 0.22
221 0.24
222 0.26
223 0.25
224 0.27
225 0.29
226 0.3
227 0.3
228 0.25
229 0.25