Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YTX7

Protein Details
Accession A0A2P7YTX7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24SCTGECKVPKKLKLKKPLHATDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8, cyto 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019191  Essential_protein_Yae1_N  
IPR038881  Yae1-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09811  Yae1_N  
Amino Acid Sequences MSCTGECKVPKKLKLKKPLHATDDDDHIWGSDDDIDTYADLQRAHVTQGYIDGITQAQEEGLQKGFDEGFPYGAALGSRVGRVLALLYGKPEFDQAKKELNTILMTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.82
4 0.84
5 0.84
6 0.79
7 0.74
8 0.7
9 0.61
10 0.58
11 0.49
12 0.39
13 0.3
14 0.25
15 0.21
16 0.15
17 0.13
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.11
33 0.1
34 0.08
35 0.09
36 0.1
37 0.08
38 0.07
39 0.07
40 0.05
41 0.06
42 0.06
43 0.04
44 0.03
45 0.05
46 0.05
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.07
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.07
62 0.06
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.11
75 0.11
76 0.12
77 0.12
78 0.16
79 0.17
80 0.17
81 0.23
82 0.24
83 0.33
84 0.33
85 0.35
86 0.32
87 0.32