Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YTR5

Protein Details
Accession A0A2P7YTR5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-32WVSSVKIVKKYTKKFKRHHSDRYDRVAENHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MGIWVSSVKIVKKYTKKFKRHHSDRYDRVAENWRKQKGIDSCVRRRFRGTIRQPNIGYGSNKKTKFLNPQGYKVYLVRNTGDLDALLMHTKTHAAEIAHNVSSKNRVEIVTKAKSLGVKVTNPKGRVALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.77
4 0.81
5 0.88
6 0.9
7 0.9
8 0.9
9 0.9
10 0.9
11 0.88
12 0.87
13 0.82
14 0.71
15 0.65
16 0.65
17 0.62
18 0.61
19 0.61
20 0.55
21 0.5
22 0.5
23 0.54
24 0.5
25 0.49
26 0.48
27 0.49
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.56
34 0.55
35 0.57
36 0.58
37 0.59
38 0.6
39 0.65
40 0.62
41 0.58
42 0.53
43 0.46
44 0.37
45 0.31
46 0.33
47 0.34
48 0.34
49 0.33
50 0.32
51 0.33
52 0.4
53 0.44
54 0.49
55 0.44
56 0.49
57 0.51
58 0.5
59 0.47
60 0.39
61 0.34
62 0.26
63 0.25
64 0.21
65 0.19
66 0.19
67 0.18
68 0.17
69 0.12
70 0.09
71 0.08
72 0.08
73 0.07
74 0.06
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.09
81 0.08
82 0.11
83 0.16
84 0.19
85 0.2
86 0.2
87 0.2
88 0.2
89 0.24
90 0.23
91 0.2
92 0.19
93 0.19
94 0.21
95 0.27
96 0.33
97 0.34
98 0.34
99 0.32
100 0.33
101 0.33
102 0.32
103 0.33
104 0.29
105 0.31
106 0.38
107 0.47
108 0.52
109 0.51
110 0.53
111 0.49