Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YHA6

Protein Details
Accession A0A2P7YHA6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-102EQRNRNQKRKGGFQNRRFNDHydrophilic
NLS Segment(s)
PositionSequence
91-93RKG
107-107R
Subcellular Location(s) nucl 16, cyto 7, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034101  Lsm4  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990726  C:Lsm1-7-Pat1 complex  
GO:0005730  C:nucleolus  
GO:0000932  C:P-body  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0005681  C:spliceosomal complex  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0005688  C:U6 snRNP  
GO:0030620  F:U2 snRNA binding  
GO:0017070  F:U6 snRNA binding  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0033962  P:P-body assembly  
GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01723  LSm4  
Amino Acid Sequences MLTSVKSQEILVELKNGESVYGKLTDCDSWMNLTLSDVVVNYNKGEKFNKLNEIYIRGSHIKFLRLPDLVMDHAKEQTLLSQEQRNRNQKRKGGFQNRRFNDHREGRGGHHRGGHNRDGHGGQGQNRRYNQALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.16
4 0.14
5 0.13
6 0.13
7 0.11
8 0.14
9 0.14
10 0.13
11 0.15
12 0.15
13 0.15
14 0.16
15 0.14
16 0.13
17 0.15
18 0.15
19 0.14
20 0.14
21 0.13
22 0.11
23 0.11
24 0.09
25 0.08
26 0.08
27 0.09
28 0.09
29 0.12
30 0.13
31 0.15
32 0.17
33 0.2
34 0.24
35 0.28
36 0.35
37 0.32
38 0.35
39 0.34
40 0.36
41 0.34
42 0.29
43 0.28
44 0.23
45 0.22
46 0.22
47 0.22
48 0.19
49 0.2
50 0.21
51 0.21
52 0.18
53 0.18
54 0.15
55 0.15
56 0.14
57 0.13
58 0.12
59 0.09
60 0.09
61 0.09
62 0.09
63 0.07
64 0.08
65 0.1
66 0.11
67 0.13
68 0.18
69 0.23
70 0.32
71 0.41
72 0.49
73 0.55
74 0.63
75 0.69
76 0.69
77 0.7
78 0.71
79 0.74
80 0.75
81 0.77
82 0.78
83 0.81
84 0.79
85 0.8
86 0.73
87 0.67
88 0.66
89 0.64
90 0.58
91 0.53
92 0.52
93 0.49
94 0.56
95 0.55
96 0.48
97 0.46
98 0.47
99 0.49
100 0.54
101 0.55
102 0.49
103 0.47
104 0.48
105 0.42
106 0.38
107 0.35
108 0.33
109 0.34
110 0.38
111 0.43
112 0.47
113 0.48
114 0.51