Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YT49

Protein Details
Accession A0A2P7YT49   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MYSYRQTAVPSRRRRRPRYFTKDIETLHydrophilic
123-153DEEEGEKKPRKGKKRGRKKKVQQNTANESNEBasic
NLS Segment(s)
PositionSequence
129-142KKPRKGKKRGRKKK
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MYSYRQTAVPSRRRRRPRYFTKDIETLLYALGDGPVSLDSTVNCLEDCLVEYLSDMMHETSQFAKSQGRSKIKQDDLPFALRNDPMKLGRLEDIKELLNKITRARNMLDESATATLEYLDDEDEEEGEKKPRKGKKRGRKKKVQQNTANESNESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.9
4 0.91
5 0.9
6 0.9
7 0.87
8 0.84
9 0.79
10 0.69
11 0.61
12 0.51
13 0.41
14 0.31
15 0.23
16 0.16
17 0.1
18 0.09
19 0.06
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.09
28 0.1
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.09
35 0.08
36 0.08
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.09
49 0.09
50 0.1
51 0.13
52 0.15
53 0.21
54 0.29
55 0.34
56 0.35
57 0.4
58 0.48
59 0.48
60 0.5
61 0.46
62 0.43
63 0.39
64 0.4
65 0.35
66 0.27
67 0.26
68 0.22
69 0.21
70 0.17
71 0.16
72 0.14
73 0.15
74 0.15
75 0.15
76 0.16
77 0.17
78 0.17
79 0.16
80 0.17
81 0.15
82 0.16
83 0.15
84 0.14
85 0.16
86 0.16
87 0.18
88 0.22
89 0.23
90 0.25
91 0.26
92 0.29
93 0.29
94 0.29
95 0.26
96 0.21
97 0.21
98 0.19
99 0.17
100 0.12
101 0.09
102 0.08
103 0.07
104 0.07
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.06
111 0.07
112 0.08
113 0.09
114 0.16
115 0.21
116 0.25
117 0.33
118 0.42
119 0.5
120 0.61
121 0.7
122 0.75
123 0.81
124 0.89
125 0.92
126 0.94
127 0.95
128 0.96
129 0.95
130 0.95
131 0.93
132 0.92
133 0.9
134 0.88
135 0.8