Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YLF4

Protein Details
Accession A0A2P7YLF4   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
114-134TKTGKTSKKSSTKSTPQPRASHydrophilic
474-499ALYDKLVKKVKEKKKHELDPEKLQWTHydrophilic
NLS Segment(s)
PositionSequence
102-123EKKPEKLKLKTGTKTGKTSKKS
484-487KEKK
Subcellular Location(s) nucl 14.5, cyto 11, mito_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR002717  HAT_MYST-type  
IPR025995  Tudor-knot  
IPR036388  WH-like_DNA-bd_sf  
IPR040706  Zf-MYST  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0032777  C:Piccolo NuA4 histone acetyltransferase complex  
GO:0140068  F:histone crotonyltransferase activity  
GO:0010485  F:histone H4 acetyltransferase activity  
GO:0106226  F:peptide 2-hydroxyisobutyryltransferase activity  
GO:0003712  F:transcription coregulator activity  
GO:0006281  P:DNA repair  
GO:0006354  P:DNA-templated transcription elongation  
GO:0016573  P:histone acetylation  
GO:0016239  P:positive regulation of macroautophagy  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0010867  P:positive regulation of triglyceride biosynthetic process  
GO:0000183  P:rDNA heterochromatin formation  
GO:0051726  P:regulation of cell cycle  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PF11717  Tudor-knot  
PF17772  zf-MYST  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MTEKEKTRLPVVDSGASIQIKAEEDEGPDPKFTVDEIISGCKVFVNKEDGKRLAEILQQNTKKGKKVFYVHYQDYNKRLDEWILPDKIDFLKLMIPPVEKEEKKPEKLKLKTGTKTGKTSKKSSTKSTPQPRASDKEESATPLENDEMDLDNLNVQGLKRPGEEVSREDEIKKLRTSGSMIQNHSEVARVRNLSSVILGEHIIEPWYFSPYPIELTEEDEIFICDFTLSYFGSKKQFERHRAKCSMKHPPGNEIYRDEKVSFWEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYIMTIRSPQGHHVVGYFSKEKESADGYNVACILTLPCYQKKGYGKLLIQFSYMLSNVENKAGSPEKPLSDLGLLSYRAFWTDVLVKLLVERCNPHLYKKNNQRELSLREDSALPPPRANGAAATAGNGASEITIEEISAITCMTTTDVLHTLSTLQIIKYHKGQHIIVITDQIMALYDKLVKKVKEKKKHELDPEKLQWTPPSFTANQLRFGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.34
4 0.29
5 0.22
6 0.2
7 0.18
8 0.18
9 0.18
10 0.13
11 0.16
12 0.21
13 0.24
14 0.23
15 0.22
16 0.22
17 0.2
18 0.19
19 0.16
20 0.16
21 0.14
22 0.15
23 0.17
24 0.21
25 0.21
26 0.21
27 0.2
28 0.17
29 0.18
30 0.17
31 0.19
32 0.23
33 0.29
34 0.36
35 0.44
36 0.45
37 0.46
38 0.46
39 0.44
40 0.39
41 0.38
42 0.38
43 0.36
44 0.44
45 0.43
46 0.47
47 0.53
48 0.54
49 0.54
50 0.53
51 0.53
52 0.52
53 0.58
54 0.62
55 0.64
56 0.69
57 0.67
58 0.71
59 0.72
60 0.68
61 0.66
62 0.62
63 0.53
64 0.45
65 0.42
66 0.35
67 0.32
68 0.34
69 0.36
70 0.33
71 0.32
72 0.3
73 0.32
74 0.3
75 0.26
76 0.2
77 0.13
78 0.16
79 0.16
80 0.2
81 0.2
82 0.2
83 0.2
84 0.26
85 0.34
86 0.3
87 0.34
88 0.42
89 0.48
90 0.54
91 0.6
92 0.63
93 0.64
94 0.68
95 0.73
96 0.72
97 0.73
98 0.71
99 0.74
100 0.74
101 0.69
102 0.72
103 0.72
104 0.71
105 0.67
106 0.68
107 0.69
108 0.69
109 0.69
110 0.69
111 0.7
112 0.71
113 0.76
114 0.8
115 0.81
116 0.77
117 0.79
118 0.76
119 0.72
120 0.68
121 0.64
122 0.55
123 0.48
124 0.43
125 0.39
126 0.34
127 0.3
128 0.25
129 0.19
130 0.18
131 0.14
132 0.13
133 0.12
134 0.11
135 0.09
136 0.09
137 0.08
138 0.09
139 0.08
140 0.08
141 0.08
142 0.06
143 0.11
144 0.12
145 0.14
146 0.13
147 0.15
148 0.16
149 0.19
150 0.22
151 0.2
152 0.23
153 0.25
154 0.25
155 0.24
156 0.26
157 0.26
158 0.27
159 0.26
160 0.23
161 0.2
162 0.22
163 0.25
164 0.29
165 0.35
166 0.37
167 0.38
168 0.37
169 0.36
170 0.35
171 0.31
172 0.26
173 0.18
174 0.14
175 0.17
176 0.16
177 0.16
178 0.18
179 0.19
180 0.16
181 0.15
182 0.13
183 0.09
184 0.09
185 0.09
186 0.07
187 0.07
188 0.07
189 0.07
190 0.06
191 0.07
192 0.06
193 0.1
194 0.09
195 0.09
196 0.11
197 0.11
198 0.13
199 0.13
200 0.14
201 0.11
202 0.14
203 0.15
204 0.14
205 0.13
206 0.11
207 0.11
208 0.09
209 0.08
210 0.05
211 0.04
212 0.04
213 0.04
214 0.05
215 0.05
216 0.06
217 0.07
218 0.1
219 0.14
220 0.16
221 0.18
222 0.25
223 0.33
224 0.42
225 0.51
226 0.56
227 0.61
228 0.67
229 0.7
230 0.68
231 0.68
232 0.69
233 0.66
234 0.65
235 0.57
236 0.55
237 0.56
238 0.52
239 0.47
240 0.4
241 0.36
242 0.32
243 0.32
244 0.26
245 0.2
246 0.19
247 0.2
248 0.16
249 0.12
250 0.18
251 0.17
252 0.24
253 0.31
254 0.34
255 0.33
256 0.38
257 0.45
258 0.47
259 0.54
260 0.51
261 0.48
262 0.5
263 0.51
264 0.49
265 0.46
266 0.38
267 0.32
268 0.28
269 0.25
270 0.21
271 0.19
272 0.2
273 0.17
274 0.17
275 0.17
276 0.17
277 0.17
278 0.15
279 0.15
280 0.12
281 0.12
282 0.11
283 0.08
284 0.08
285 0.07
286 0.06
287 0.06
288 0.07
289 0.07
290 0.08
291 0.09
292 0.1
293 0.11
294 0.14
295 0.16
296 0.16
297 0.15
298 0.15
299 0.17
300 0.15
301 0.19
302 0.18
303 0.14
304 0.15
305 0.15
306 0.15
307 0.15
308 0.17
309 0.14
310 0.14
311 0.18
312 0.17
313 0.17
314 0.17
315 0.15
316 0.12
317 0.11
318 0.1
319 0.08
320 0.12
321 0.15
322 0.16
323 0.19
324 0.2
325 0.26
326 0.31
327 0.34
328 0.37
329 0.4
330 0.41
331 0.44
332 0.48
333 0.43
334 0.38
335 0.32
336 0.26
337 0.21
338 0.18
339 0.13
340 0.09
341 0.12
342 0.12
343 0.13
344 0.12
345 0.1
346 0.15
347 0.17
348 0.17
349 0.19
350 0.22
351 0.21
352 0.23
353 0.23
354 0.2
355 0.19
356 0.18
357 0.15
358 0.15
359 0.15
360 0.13
361 0.14
362 0.12
363 0.12
364 0.13
365 0.11
366 0.1
367 0.14
368 0.15
369 0.16
370 0.16
371 0.15
372 0.17
373 0.22
374 0.21
375 0.19
376 0.2
377 0.22
378 0.3
379 0.31
380 0.36
381 0.4
382 0.44
383 0.53
384 0.62
385 0.68
386 0.69
387 0.7
388 0.69
389 0.67
390 0.67
391 0.65
392 0.57
393 0.47
394 0.39
395 0.39
396 0.34
397 0.36
398 0.38
399 0.31
400 0.28
401 0.28
402 0.29
403 0.29
404 0.28
405 0.2
406 0.15
407 0.17
408 0.17
409 0.17
410 0.15
411 0.14
412 0.13
413 0.12
414 0.09
415 0.05
416 0.05
417 0.04
418 0.05
419 0.05
420 0.05
421 0.05
422 0.06
423 0.06
424 0.06
425 0.06
426 0.04
427 0.04
428 0.04
429 0.06
430 0.07
431 0.07
432 0.1
433 0.12
434 0.13
435 0.13
436 0.13
437 0.12
438 0.12
439 0.14
440 0.13
441 0.11
442 0.15
443 0.19
444 0.22
445 0.28
446 0.34
447 0.35
448 0.39
449 0.4
450 0.41
451 0.42
452 0.41
453 0.36
454 0.32
455 0.28
456 0.24
457 0.23
458 0.16
459 0.13
460 0.11
461 0.1
462 0.08
463 0.14
464 0.15
465 0.21
466 0.28
467 0.3
468 0.39
469 0.5
470 0.59
471 0.64
472 0.71
473 0.77
474 0.81
475 0.88
476 0.9
477 0.9
478 0.87
479 0.87
480 0.86
481 0.8
482 0.7
483 0.63
484 0.59
485 0.53
486 0.49
487 0.4
488 0.39
489 0.36
490 0.42
491 0.5
492 0.45