Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q1K580

Protein Details
Accession Q1K580    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-71SKITRRMSKTRQEKRSKVKPFIHydrophilic
NLS Segment(s)
PositionSequence
60-65RQEKRS
Subcellular Location(s) mito 23.5, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR041991  KOW_RPL27  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR018262  Ribosomal_L27e_CS  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU01827  -  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
PROSITE View protein in PROSITE  
PS01107  RIBOSOMAL_L27E  
CDD cd06090  KOW_RPL27  
Amino Acid Sequences MKFLKTSRVCLVTRGRYAGKKVVIIQPVDNGSKTHPYGHAIVAGIERYPSKITRRMSKTRQEKRSKVKPFIKVINYNHLMPTRYTLELEGLKGSVSAETFKEVSQREDAKKTVKKVLEERYTSGKNRWFFTPLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.48
4 0.52
5 0.53
6 0.46
7 0.41
8 0.42
9 0.43
10 0.42
11 0.39
12 0.36
13 0.33
14 0.33
15 0.31
16 0.28
17 0.22
18 0.2
19 0.24
20 0.24
21 0.22
22 0.2
23 0.21
24 0.23
25 0.23
26 0.22
27 0.17
28 0.16
29 0.15
30 0.13
31 0.1
32 0.09
33 0.09
34 0.08
35 0.1
36 0.12
37 0.15
38 0.22
39 0.25
40 0.34
41 0.42
42 0.49
43 0.55
44 0.62
45 0.69
46 0.72
47 0.79
48 0.79
49 0.8
50 0.81
51 0.83
52 0.81
53 0.8
54 0.77
55 0.74
56 0.71
57 0.69
58 0.65
59 0.63
60 0.57
61 0.56
62 0.51
63 0.44
64 0.41
65 0.35
66 0.31
67 0.23
68 0.24
69 0.19
70 0.17
71 0.17
72 0.15
73 0.16
74 0.16
75 0.16
76 0.13
77 0.1
78 0.09
79 0.09
80 0.09
81 0.07
82 0.06
83 0.07
84 0.07
85 0.09
86 0.1
87 0.1
88 0.15
89 0.16
90 0.18
91 0.24
92 0.29
93 0.32
94 0.36
95 0.38
96 0.43
97 0.48
98 0.5
99 0.51
100 0.5
101 0.52
102 0.55
103 0.63
104 0.62
105 0.6
106 0.59
107 0.6
108 0.61
109 0.57
110 0.56
111 0.53
112 0.48
113 0.48
114 0.47
115 0.44