Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K4M5

Protein Details
Accession Q1K4M5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-98DASRRPGQQHPPRGSKKRKMLVDNGQRTHydrophilic
NLS Segment(s)
PositionSequence
82-88PRGSKKR
Subcellular Location(s) extr 14, plas 9, mito 3
Family & Domain DBs
KEGG ncr:NCU03553  -  
Amino Acid Sequences MWRPLWHLGPCVSVSVCVCVCAGGHRESQSVSQSTLELDSGIRKNGEPQARSRPSTHWPVVRDIDQECSVDASRRPGQQHPPRGSKKRKMLVDNGQRTMAVAPVFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.17
4 0.15
5 0.14
6 0.12
7 0.11
8 0.13
9 0.16
10 0.14
11 0.17
12 0.18
13 0.19
14 0.2
15 0.22
16 0.22
17 0.2
18 0.19
19 0.16
20 0.15
21 0.15
22 0.14
23 0.12
24 0.08
25 0.07
26 0.11
27 0.11
28 0.12
29 0.12
30 0.11
31 0.14
32 0.2
33 0.25
34 0.22
35 0.25
36 0.35
37 0.38
38 0.4
39 0.39
40 0.36
41 0.36
42 0.42
43 0.41
44 0.35
45 0.33
46 0.35
47 0.36
48 0.34
49 0.32
50 0.25
51 0.25
52 0.22
53 0.2
54 0.16
55 0.16
56 0.14
57 0.15
58 0.15
59 0.17
60 0.21
61 0.25
62 0.28
63 0.31
64 0.42
65 0.49
66 0.59
67 0.6
68 0.66
69 0.72
70 0.79
71 0.84
72 0.83
73 0.84
74 0.83
75 0.83
76 0.79
77 0.79
78 0.79
79 0.8
80 0.79
81 0.71
82 0.63
83 0.55
84 0.49
85 0.41
86 0.33