Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YST2

Protein Details
Accession A0A2P7YST2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-56VPKTRKTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MEGMQKPKCTAEANYTEKAKYTEKANFINVPKTRKTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.44
4 0.42
5 0.43
6 0.37
7 0.3
8 0.3
9 0.32
10 0.35
11 0.38
12 0.41
13 0.43
14 0.43
15 0.49
16 0.48
17 0.46
18 0.44
19 0.46
20 0.46
21 0.46
22 0.49
23 0.51
24 0.56
25 0.61
26 0.67
27 0.72
28 0.79
29 0.79
30 0.84
31 0.84
32 0.85
33 0.84
34 0.85
35 0.82
36 0.83
37 0.85
38 0.77
39 0.76
40 0.69
41 0.63
42 0.55
43 0.49
44 0.39
45 0.3
46 0.29
47 0.28
48 0.27
49 0.24
50 0.3
51 0.33
52 0.37
53 0.41
54 0.45
55 0.42
56 0.49
57 0.56
58 0.54
59 0.56
60 0.55
61 0.56
62 0.55
63 0.58
64 0.5
65 0.46
66 0.42
67 0.35
68 0.38
69 0.4
70 0.39
71 0.34
72 0.41
73 0.45
74 0.54
75 0.62
76 0.65
77 0.64
78 0.68
79 0.74
80 0.75
81 0.73
82 0.69
83 0.64
84 0.6
85 0.57
86 0.52
87 0.45
88 0.41
89 0.34
90 0.29
91 0.27
92 0.26
93 0.3
94 0.35
95 0.39
96 0.44
97 0.54
98 0.61
99 0.66
100 0.64
101 0.6
102 0.56
103 0.52
104 0.5
105 0.5
106 0.51
107 0.54
108 0.6
109 0.58
110 0.59
111 0.62
112 0.58