Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YXL0

Protein Details
Accession A0A2P7YXL0   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-27NTIRGFGRSSKKTKKDYEAPGILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.166, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Gene Ontology GO:0005938  C:cell cortex  
GO:0032153  C:cell division site  
GO:0005935  C:cellular bud neck  
GO:0005934  C:cellular bud tip  
GO:0043332  C:mating projection tip  
GO:0005634  C:nucleus  
GO:1902554  C:serine/threonine protein kinase complex  
GO:0030295  F:protein kinase activator activity  
GO:0007118  P:budding cell apical bud growth  
GO:0007163  P:establishment or maintenance of cell polarity  
GO:0001934  P:positive regulation of protein phosphorylation  
GO:0006468  P:protein phosphorylation  
GO:0062200  P:RAM/MOR signaling pathway  
GO:2000100  P:regulation of establishment or maintenance of bipolar cell polarity regulating cell shape  
GO:0000920  P:septum digestion after cytokinesis  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MSFLNTIRGFGRSSKKTKKDYEAPGILAPHGNGNVSPMRRSQLPSKMSPSKRGSQIQFAPSSPTRISRMARSRLPQRQTYSTSETEEPPLFLCEPFVKTALVKGSFKTIVQLPKYVDYGEWLSLNIFELFNHLNQFYGIISDYITPELNPTMNAGPNTNYLWIDTSGQPVNLPADQYIEYVLTWISNKINDQSVFPTKDGGAFPPNFIKDCKNIVRQMFRIFAHIYHNHFEKLVHLSLEAHWNSFFAHFISFGKEFNLIDKKELVPLLPLIENFEKQGKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.71
4 0.78
5 0.81
6 0.8
7 0.81
8 0.81
9 0.76
10 0.7
11 0.64
12 0.56
13 0.48
14 0.39
15 0.3
16 0.23
17 0.18
18 0.16
19 0.12
20 0.15
21 0.2
22 0.2
23 0.21
24 0.21
25 0.23
26 0.26
27 0.3
28 0.35
29 0.38
30 0.42
31 0.45
32 0.52
33 0.58
34 0.59
35 0.64
36 0.63
37 0.61
38 0.64
39 0.66
40 0.61
41 0.6
42 0.63
43 0.59
44 0.56
45 0.48
46 0.47
47 0.4
48 0.41
49 0.34
50 0.31
51 0.29
52 0.31
53 0.33
54 0.36
55 0.44
56 0.46
57 0.5
58 0.53
59 0.59
60 0.63
61 0.66
62 0.63
63 0.6
64 0.6
65 0.59
66 0.58
67 0.54
68 0.47
69 0.46
70 0.41
71 0.37
72 0.34
73 0.3
74 0.24
75 0.19
76 0.19
77 0.16
78 0.14
79 0.14
80 0.12
81 0.13
82 0.14
83 0.14
84 0.12
85 0.12
86 0.14
87 0.17
88 0.19
89 0.18
90 0.17
91 0.2
92 0.2
93 0.2
94 0.2
95 0.19
96 0.22
97 0.23
98 0.26
99 0.23
100 0.24
101 0.25
102 0.23
103 0.19
104 0.15
105 0.15
106 0.13
107 0.12
108 0.1
109 0.09
110 0.09
111 0.1
112 0.08
113 0.07
114 0.05
115 0.08
116 0.08
117 0.09
118 0.1
119 0.09
120 0.08
121 0.08
122 0.08
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.06
136 0.06
137 0.07
138 0.08
139 0.09
140 0.1
141 0.1
142 0.11
143 0.12
144 0.13
145 0.12
146 0.11
147 0.1
148 0.11
149 0.11
150 0.12
151 0.11
152 0.13
153 0.13
154 0.13
155 0.12
156 0.12
157 0.12
158 0.1
159 0.1
160 0.07
161 0.09
162 0.09
163 0.1
164 0.1
165 0.08
166 0.08
167 0.07
168 0.07
169 0.06
170 0.06
171 0.07
172 0.08
173 0.08
174 0.09
175 0.11
176 0.16
177 0.16
178 0.17
179 0.21
180 0.27
181 0.28
182 0.27
183 0.27
184 0.22
185 0.25
186 0.24
187 0.21
188 0.21
189 0.19
190 0.21
191 0.24
192 0.26
193 0.24
194 0.25
195 0.25
196 0.23
197 0.3
198 0.35
199 0.36
200 0.4
201 0.46
202 0.51
203 0.51
204 0.52
205 0.49
206 0.43
207 0.41
208 0.36
209 0.31
210 0.32
211 0.32
212 0.32
213 0.31
214 0.33
215 0.3
216 0.29
217 0.28
218 0.24
219 0.24
220 0.22
221 0.18
222 0.17
223 0.17
224 0.19
225 0.27
226 0.24
227 0.2
228 0.18
229 0.18
230 0.19
231 0.18
232 0.17
233 0.1
234 0.1
235 0.1
236 0.11
237 0.16
238 0.16
239 0.16
240 0.16
241 0.18
242 0.17
243 0.23
244 0.3
245 0.26
246 0.27
247 0.3
248 0.3
249 0.32
250 0.33
251 0.26
252 0.21
253 0.21
254 0.22
255 0.21
256 0.2
257 0.22
258 0.25
259 0.25
260 0.25
261 0.28