FuNGI

Q7SA90

Protein Details

Accession

Q7SA90

Localization Confidence

Low

Confidence Score

8.3

NoLS Segment(s)

Position	Sequence	Protein Nature
1-28	MKIRRLFKYHSLKKKPIRPTWNKYNLYN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 10, mito 10, mito_nucl 10

Family & Domain DBs

InterPro	View protein in InterPro IPR022801 Ribosomal_S4/S9 IPR018079 Ribosomal_S4_CS IPR002942 S4_RNA-bd IPR036986 S4_RNA-bd_sf
Gene Ontology	GO:0005763 C:mitochondrial small ribosomal subunit GO:0019843 F:rRNA binding GO:0003735 F:structural constituent of ribosome GO:0042274 P:ribosomal small subunit biogenesis
KEGG	ncr:NCU08296 -
Pfam	View protein in Pfam PF01479 S4
PROSITE	View protein in PROSITE PS00632 RIBOSOMAL_S4 PS50889 S4
CDD	cd00165 S4

Amino Acid Sequences

MKIRRLFKYHSLKKKPIRPTWNKYNLYNLATAGREPRISGKTFFQQKWLAKSLTRAYHGEHIKERKWARMFSRRLPAVVNMDPAYMAKYNGSEQAAGRGSGLSEPPAYEKTADEKPAKQVIANPGRKVPTPYEQMTFAPLERRLDIAIFRALFASSARQARQMVVHGAVTVNGKKMKHPGYLLNPGDLFQVDVERVLYATGAPKDKKLLAAAMKAAKKELAEEAQEAAEEKDAEAEEAEEGEAQEAASKSGKKEKQVDTSKFDEAWNRKYELLQLQRLLQYAKHIADSPSHQLSATRKQALRALKRDIKAAIKQAQRRDGSVSPTGNVVDDLTMLLERLAVSPSKAIQQEEAAKELSKKLDKQSRQVLKKVIEYNDEHEDNEIDPSKPYMTPWRPRNYMSAFAFIPRYLEVNQNICAAVYLRHPVARPGESEVPSPFSPTINQLAFNWYLRRG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.89
2	0.89
3	0.88
4	0.89
5	0.88
6	0.88
7	0.89
8	0.9
9	0.86
10	0.78
11	0.77
12	0.72
13	0.65
14	0.56
15	0.47
16	0.4
17	0.35
18	0.34
19	0.29
20	0.25
21	0.23
22	0.22
23	0.28
24	0.29
25	0.31
26	0.33
27	0.34
28	0.4
29	0.49
30	0.49
31	0.48
32	0.52
33	0.54
34	0.58
35	0.59
36	0.52
37	0.45
38	0.51
39	0.52
40	0.5
41	0.49
42	0.43
43	0.41
44	0.47
45	0.49
46	0.48
47	0.48
48	0.49
49	0.48
50	0.56
51	0.54
52	0.55
53	0.55
54	0.57
55	0.57
56	0.6
57	0.64
58	0.63
59	0.71
60	0.64
61	0.6
62	0.55
63	0.51
64	0.47
65	0.42
66	0.38
67	0.28
68	0.27
69	0.25
70	0.23
71	0.22
72	0.16
73	0.14
74	0.11
75	0.11
76	0.13
77	0.17
78	0.18
79	0.16
80	0.16
81	0.22
82	0.22
83	0.21
84	0.2
85	0.16
86	0.15
87	0.15
88	0.15
89	0.1
90	0.1
91	0.1
92	0.12
93	0.14
94	0.14
95	0.14
96	0.14
97	0.17
98	0.22
99	0.27
100	0.28
101	0.29
102	0.34
103	0.39
104	0.38
105	0.35
106	0.35
107	0.39
108	0.46
109	0.49
110	0.44
111	0.43
112	0.45
113	0.45
114	0.44
115	0.38
116	0.34
117	0.36
118	0.37
119	0.34
120	0.34
121	0.33
122	0.32
123	0.29
124	0.23
125	0.21
126	0.2
127	0.2
128	0.19
129	0.19
130	0.17
131	0.17
132	0.16
133	0.14
134	0.16
135	0.14
136	0.13
137	0.13
138	0.12
139	0.12
140	0.11
141	0.12
142	0.12
143	0.16
144	0.16
145	0.18
146	0.19
147	0.2
148	0.21
149	0.21
150	0.19
151	0.16
152	0.16
153	0.13
154	0.13
155	0.13
156	0.13
157	0.11
158	0.12
159	0.14
160	0.15
161	0.16
162	0.23
163	0.26
164	0.27
165	0.29
166	0.32
167	0.36
168	0.45
169	0.44
170	0.39
171	0.35
172	0.32
173	0.3
174	0.23
175	0.17
176	0.07
177	0.07
178	0.05
179	0.06
180	0.05
181	0.05
182	0.05
183	0.04
184	0.04
185	0.04
186	0.07
187	0.09
188	0.13
189	0.14
190	0.15
191	0.17
192	0.18
193	0.18
194	0.16
195	0.18
196	0.16
197	0.17
198	0.2
199	0.24
200	0.24
201	0.23
202	0.23
203	0.19
204	0.17
205	0.16
206	0.15
207	0.11
208	0.11
209	0.11
210	0.12
211	0.11
212	0.11
213	0.1
214	0.08
215	0.07
216	0.06
217	0.05
218	0.06
219	0.06
220	0.06
221	0.05
222	0.05
223	0.04
224	0.04
225	0.05
226	0.04
227	0.04
228	0.04
229	0.04
230	0.03
231	0.05
232	0.05
233	0.06
234	0.08
235	0.09
236	0.1
237	0.19
238	0.22
239	0.25
240	0.33
241	0.38
242	0.46
243	0.55
244	0.58
245	0.55
246	0.56
247	0.53
248	0.46
249	0.41
250	0.38
251	0.33
252	0.34
253	0.32
254	0.3
255	0.29
256	0.28
257	0.32
258	0.32
259	0.34
260	0.32
261	0.3
262	0.31
263	0.32
264	0.33
265	0.29
266	0.21
267	0.18
268	0.18
269	0.18
270	0.16
271	0.16
272	0.16
273	0.18
274	0.21
275	0.23
276	0.21
277	0.2
278	0.19
279	0.21
280	0.24
281	0.31
282	0.34
283	0.35
284	0.34
285	0.36
286	0.41
287	0.47
288	0.51
289	0.48
290	0.51
291	0.51
292	0.52
293	0.53
294	0.51
295	0.48
296	0.43
297	0.45
298	0.44
299	0.44
300	0.48
301	0.52
302	0.56
303	0.52
304	0.49
305	0.47
306	0.42
307	0.4
308	0.41
309	0.36
310	0.28
311	0.28
312	0.26
313	0.21
314	0.18
315	0.14
316	0.08
317	0.07
318	0.06
319	0.06
320	0.05
321	0.05
322	0.05
323	0.05
324	0.05
325	0.06
326	0.07
327	0.07
328	0.07
329	0.09
330	0.1
331	0.15
332	0.16
333	0.17
334	0.17
335	0.21
336	0.28
337	0.28
338	0.29
339	0.25
340	0.24
341	0.25
342	0.27
343	0.28
344	0.27
345	0.29
346	0.36
347	0.45
348	0.49
349	0.56
350	0.63
351	0.67
352	0.68
353	0.7
354	0.68
355	0.63
356	0.66
357	0.64
358	0.57
359	0.52
360	0.49
361	0.48
362	0.48
363	0.44
364	0.37
365	0.31
366	0.29
367	0.23
368	0.25
369	0.23
370	0.16
371	0.16
372	0.17
373	0.18
374	0.17
375	0.2
376	0.26
377	0.33
378	0.42
379	0.51
380	0.58
381	0.6
382	0.62
383	0.68
384	0.63
385	0.63
386	0.55
387	0.51
388	0.42
389	0.41
390	0.4
391	0.32
392	0.28
393	0.2
394	0.2
395	0.17
396	0.23
397	0.25
398	0.26
399	0.28
400	0.28
401	0.27
402	0.24
403	0.23
404	0.18
405	0.15
406	0.15
407	0.17
408	0.18
409	0.21
410	0.22
411	0.26
412	0.32
413	0.32
414	0.31
415	0.34
416	0.4
417	0.39
418	0.41
419	0.38
420	0.38
421	0.35
422	0.37
423	0.31
424	0.24
425	0.25
426	0.26
427	0.31
428	0.27
429	0.29
430	0.26
431	0.3
432	0.32
433	0.34

Q7SA90

3D AlphaFold-predicted Structure Viewer