Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YK12

Protein Details
Accession A0A2P7YK12    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
195-214YNDPNLLAPKKKRRTNSRDQHydrophilic
NLS Segment(s)
PositionSequence
204-207KKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MASTNTEATSASSGSNDSSNKDISLIPQELDDTDYGKVYEELQQHFHEVYTVSQRLAVTEKAQRQTLYSYRRKIDALLDYMAELEGRDEEPIEQPLDLDSRRIEEILQKKPELQLTLGPLLQIAHNEQPANIKFKKSYNANLAVDELIPDIRQDELGTVEVNPQETEMWVRRNYPHLVVSKFKPIEIRGKDVREYNDPNLLAPKKKRRTNSRDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.17
3 0.16
4 0.16
5 0.19
6 0.19
7 0.19
8 0.2
9 0.19
10 0.18
11 0.24
12 0.23
13 0.2
14 0.19
15 0.19
16 0.18
17 0.19
18 0.17
19 0.11
20 0.1
21 0.11
22 0.1
23 0.11
24 0.11
25 0.1
26 0.16
27 0.19
28 0.21
29 0.24
30 0.24
31 0.25
32 0.25
33 0.24
34 0.19
35 0.15
36 0.15
37 0.18
38 0.19
39 0.17
40 0.18
41 0.18
42 0.19
43 0.2
44 0.19
45 0.16
46 0.22
47 0.28
48 0.28
49 0.3
50 0.29
51 0.28
52 0.32
53 0.36
54 0.39
55 0.41
56 0.44
57 0.44
58 0.46
59 0.45
60 0.41
61 0.38
62 0.33
63 0.29
64 0.24
65 0.22
66 0.19
67 0.19
68 0.17
69 0.12
70 0.07
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.07
78 0.08
79 0.08
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.09
86 0.07
87 0.09
88 0.09
89 0.09
90 0.09
91 0.13
92 0.2
93 0.26
94 0.28
95 0.27
96 0.27
97 0.29
98 0.31
99 0.25
100 0.2
101 0.15
102 0.16
103 0.17
104 0.16
105 0.14
106 0.12
107 0.11
108 0.11
109 0.09
110 0.08
111 0.08
112 0.1
113 0.1
114 0.1
115 0.15
116 0.17
117 0.22
118 0.21
119 0.22
120 0.22
121 0.25
122 0.32
123 0.31
124 0.35
125 0.36
126 0.43
127 0.42
128 0.4
129 0.38
130 0.32
131 0.28
132 0.22
133 0.15
134 0.08
135 0.07
136 0.06
137 0.06
138 0.05
139 0.06
140 0.05
141 0.06
142 0.07
143 0.08
144 0.08
145 0.08
146 0.1
147 0.11
148 0.11
149 0.11
150 0.1
151 0.09
152 0.1
153 0.14
154 0.15
155 0.19
156 0.2
157 0.23
158 0.25
159 0.3
160 0.33
161 0.32
162 0.34
163 0.35
164 0.38
165 0.4
166 0.41
167 0.46
168 0.43
169 0.41
170 0.4
171 0.37
172 0.43
173 0.42
174 0.47
175 0.44
176 0.48
177 0.5
178 0.51
179 0.52
180 0.5
181 0.52
182 0.48
183 0.49
184 0.45
185 0.42
186 0.45
187 0.46
188 0.46
189 0.49
190 0.57
191 0.59
192 0.67
193 0.76
194 0.78