Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YH92

Protein Details
Accession A0A2P7YH92    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-135LNDIMGKSKKGKKRKAEKSEKSDKPLKKSKKPKKQSSBasic
NLS Segment(s)
PositionSequence
105-134KSKKGKKRKAEKSEKSDKPLKKSKKPKKQS
Subcellular Location(s) nucl 21.5, mito_nucl 12.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MAGLSQNVLNMKFMKGGDNKTPPSNQPTTYKRVKDPSEWFLPNRGQVQQKIKPAMKVSTVGYGSIASFTAEDSEPEKEEVQEEKPAPKKDKSQEADEFLNDIMGKSKKGKKRKAEKSEKSDKPLKKSKKPKKQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.3
4 0.37
5 0.43
6 0.45
7 0.46
8 0.5
9 0.46
10 0.49
11 0.48
12 0.43
13 0.44
14 0.46
15 0.48
16 0.54
17 0.54
18 0.53
19 0.57
20 0.58
21 0.57
22 0.58
23 0.57
24 0.56
25 0.55
26 0.5
27 0.47
28 0.45
29 0.4
30 0.36
31 0.35
32 0.31
33 0.34
34 0.41
35 0.41
36 0.45
37 0.49
38 0.48
39 0.46
40 0.45
41 0.41
42 0.34
43 0.31
44 0.26
45 0.23
46 0.22
47 0.18
48 0.16
49 0.14
50 0.12
51 0.1
52 0.09
53 0.05
54 0.04
55 0.04
56 0.06
57 0.05
58 0.06
59 0.07
60 0.08
61 0.09
62 0.1
63 0.11
64 0.09
65 0.11
66 0.12
67 0.13
68 0.17
69 0.17
70 0.22
71 0.28
72 0.34
73 0.37
74 0.39
75 0.45
76 0.47
77 0.57
78 0.54
79 0.55
80 0.55
81 0.55
82 0.53
83 0.45
84 0.39
85 0.29
86 0.26
87 0.18
88 0.13
89 0.14
90 0.13
91 0.15
92 0.21
93 0.29
94 0.37
95 0.47
96 0.57
97 0.63
98 0.73
99 0.82
100 0.86
101 0.9
102 0.92
103 0.91
104 0.92
105 0.89
106 0.86
107 0.84
108 0.79
109 0.77
110 0.78
111 0.78
112 0.78
113 0.82
114 0.86
115 0.87