FuNGI

A0A2P7YCK7

Protein Details

Accession

A0A2P7YCK7

Localization Confidence

Low

Confidence Score

9.6

NoLS Segment(s)

Position	Sequence	Protein Nature
641-661	ALPNPRRFERKEKLYPSGRGS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, cyto_nucl 10, mito 9

Family & Domain DBs

InterPro	View protein in InterPro IPR003882 Pistil_extensin IPR003124 WH2_dom
Gene Ontology	GO:0030479 C:actin cortical patch GO:0003779 F:actin binding
Pfam	View protein in Pfam PF02205 WH2
PROSITE	View protein in PROSITE PS51082 WH2
CDD	cd22064 WH2_WAS_WASL

Amino Acid Sequences

MPKGRDALLGDIRKGANLKKATTVDKSGPLLGSGGSSAATPGFLLPLPAPTSLPAPLGAPAPPQLGDLFLGGMPKLKSVKDNRSGIVPLAPPPVPPTLAPKSPAPPETAAPAVPKMPSSRPLKTPAVPKSTPAPPSAAPPIPSSPPPVPGSTSSLQVPKAPPRPSKKGHLKLASVSSVSSVELAALNRGPPPVPSAPPPTAAPPVPSAPPPVPSAPPPPTMAPKAPLAPKDSGAPAAPLPPPGGLPFLSEINAKRNDSHVVDNAGGSAPSAPSSRPKAAHKGPPASSAPPIPSAPPPVPSAPTPPVPLAPPPPTLAPKPPSSGPPKPPASGPPKLPTSAPPPPTNLAPPPPPLIPPPPLLLLSKPSSKLDAPKAPALPGGSLPFLDQINAKRNDSTVVDGTSSYSTYNLEASTPQLSTPKPPSGAPPIPLSVPKPPTSSVPKPPTSSAPKAPASSAPEPPSGPAPSFLDQLNARNKAQTSKSPAPSAAPPIPQSLAPSAPSQAPPTPQAPPVPTSLPPTPLAPSQAPPTPLIPTQAPPPPRAPSPPLAPPPLLFPPPPLASLAPLAPSLPKQTPPAPSSYKPKKAAPPPPPSTMEQQQSTGQNLRKISALDYTINTQQRNGSSSERLVIEDTRFKWVNSDALPNPRRFERKEKLYPSGRGSSVPLDLLLF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.34
3	0.33
4	0.34
5	0.36
6	0.39
7	0.44
8	0.47
9	0.49
10	0.51
11	0.47
12	0.49
13	0.49
14	0.44
15	0.39
16	0.34
17	0.29
18	0.23
19	0.19
20	0.13
21	0.1
22	0.08
23	0.07
24	0.07
25	0.07
26	0.06
27	0.06
28	0.06
29	0.07
30	0.07
31	0.09
32	0.09
33	0.13
34	0.15
35	0.15
36	0.16
37	0.15
38	0.17
39	0.17
40	0.17
41	0.14
42	0.13
43	0.14
44	0.14
45	0.14
46	0.14
47	0.15
48	0.16
49	0.15
50	0.15
51	0.14
52	0.14
53	0.14
54	0.12
55	0.11
56	0.1
57	0.1
58	0.09
59	0.13
60	0.12
61	0.15
62	0.17
63	0.18
64	0.25
65	0.33
66	0.43
67	0.48
68	0.53
69	0.51
70	0.53
71	0.53
72	0.46
73	0.43
74	0.34
75	0.28
76	0.28
77	0.27
78	0.23
79	0.24
80	0.25
81	0.21
82	0.21
83	0.25
84	0.27
85	0.3
86	0.33
87	0.34
88	0.36
89	0.41
90	0.42
91	0.38
92	0.34
93	0.32
94	0.33
95	0.31
96	0.27
97	0.24
98	0.23
99	0.21
100	0.19
101	0.19
102	0.19
103	0.21
104	0.28
105	0.33
106	0.37
107	0.4
108	0.46
109	0.5
110	0.51
111	0.57
112	0.57
113	0.59
114	0.54
115	0.52
116	0.51
117	0.52
118	0.49
119	0.42
120	0.37
121	0.29
122	0.34
123	0.38
124	0.35
125	0.3
126	0.3
127	0.32
128	0.31
129	0.32
130	0.33
131	0.27
132	0.3
133	0.31
134	0.29
135	0.28
136	0.28
137	0.33
138	0.28
139	0.29
140	0.26
141	0.26
142	0.26
143	0.27
144	0.29
145	0.31
146	0.38
147	0.43
148	0.49
149	0.55
150	0.63
151	0.64
152	0.71
153	0.73
154	0.74
155	0.77
156	0.75
157	0.69
158	0.65
159	0.64
160	0.56
161	0.45
162	0.35
163	0.27
164	0.21
165	0.18
166	0.13
167	0.08
168	0.07
169	0.08
170	0.08
171	0.08
172	0.08
173	0.09
174	0.1
175	0.1
176	0.1
177	0.09
178	0.14
179	0.16
180	0.18
181	0.22
182	0.27
183	0.28
184	0.3
185	0.31
186	0.29
187	0.29
188	0.27
189	0.25
190	0.21
191	0.22
192	0.21
193	0.21
194	0.22
195	0.19
196	0.2
197	0.21
198	0.21
199	0.21
200	0.22
201	0.28
202	0.28
203	0.29
204	0.29
205	0.29
206	0.31
207	0.33
208	0.32
209	0.27
210	0.26
211	0.28
212	0.3
213	0.3
214	0.29
215	0.27
216	0.26
217	0.26
218	0.25
219	0.21
220	0.18
221	0.17
222	0.13
223	0.15
224	0.14
225	0.13
226	0.12
227	0.11
228	0.11
229	0.11
230	0.12
231	0.09
232	0.1
233	0.1
234	0.1
235	0.11
236	0.12
237	0.13
238	0.17
239	0.21
240	0.2
241	0.19
242	0.21
243	0.24
244	0.24
245	0.26
246	0.23
247	0.21
248	0.21
249	0.2
250	0.18
251	0.15
252	0.12
253	0.09
254	0.07
255	0.05
256	0.06
257	0.06
258	0.06
259	0.11
260	0.16
261	0.2
262	0.23
263	0.27
264	0.34
265	0.4
266	0.47
267	0.49
268	0.51
269	0.48
270	0.5
271	0.48
272	0.42
273	0.37
274	0.3
275	0.25
276	0.21
277	0.2
278	0.17
279	0.16
280	0.18
281	0.17
282	0.18
283	0.19
284	0.18
285	0.19
286	0.18
287	0.22
288	0.2
289	0.21
290	0.21
291	0.19
292	0.19
293	0.18
294	0.19
295	0.19
296	0.19
297	0.18
298	0.18
299	0.19
300	0.21
301	0.21
302	0.25
303	0.24
304	0.23
305	0.24
306	0.24
307	0.28
308	0.33
309	0.38
310	0.38
311	0.43
312	0.43
313	0.42
314	0.41
315	0.43
316	0.42
317	0.4
318	0.38
319	0.35
320	0.34
321	0.34
322	0.33
323	0.29
324	0.29
325	0.32
326	0.32
327	0.29
328	0.3
329	0.3
330	0.31
331	0.31
332	0.25
333	0.22
334	0.2
335	0.21
336	0.21
337	0.2
338	0.2
339	0.2
340	0.21
341	0.21
342	0.2
343	0.19
344	0.18
345	0.19
346	0.19
347	0.17
348	0.17
349	0.17
350	0.18
351	0.18
352	0.18
353	0.19
354	0.19
355	0.24
356	0.26
357	0.29
358	0.3
359	0.32
360	0.32
361	0.3
362	0.3
363	0.26
364	0.2
365	0.15
366	0.14
367	0.1
368	0.09
369	0.09
370	0.09
371	0.09
372	0.09
373	0.09
374	0.11
375	0.2
376	0.22
377	0.22
378	0.21
379	0.22
380	0.24
381	0.23
382	0.22
383	0.15
384	0.14
385	0.14
386	0.13
387	0.14
388	0.13
389	0.12
390	0.09
391	0.08
392	0.07
393	0.07
394	0.08
395	0.07
396	0.07
397	0.07
398	0.09
399	0.1
400	0.09
401	0.09
402	0.12
403	0.12
404	0.16
405	0.21
406	0.22
407	0.22
408	0.23
409	0.26
410	0.32
411	0.35
412	0.32
413	0.3
414	0.27
415	0.27
416	0.28
417	0.27
418	0.24
419	0.25
420	0.25
421	0.25
422	0.25
423	0.29
424	0.36
425	0.4
426	0.43
427	0.47
428	0.49
429	0.49
430	0.5
431	0.53
432	0.52
433	0.51
434	0.46
435	0.46
436	0.44
437	0.43
438	0.42
439	0.38
440	0.38
441	0.36
442	0.36
443	0.32
444	0.31
445	0.3
446	0.3
447	0.29
448	0.24
449	0.21
450	0.18
451	0.19
452	0.19
453	0.2
454	0.19
455	0.19
456	0.19
457	0.24
458	0.3
459	0.29
460	0.28
461	0.3
462	0.31
463	0.33
464	0.36
465	0.36
466	0.38
467	0.43
468	0.47
469	0.46
470	0.46
471	0.43
472	0.42
473	0.42
474	0.36
475	0.31
476	0.28
477	0.28
478	0.28
479	0.26
480	0.25
481	0.21
482	0.18
483	0.17
484	0.17
485	0.16
486	0.18
487	0.19
488	0.2
489	0.2
490	0.21
491	0.22
492	0.24
493	0.25
494	0.26
495	0.28
496	0.27
497	0.27
498	0.28
499	0.27
500	0.26
501	0.29
502	0.29
503	0.28
504	0.27
505	0.27
506	0.25
507	0.24
508	0.27
509	0.23
510	0.23
511	0.24
512	0.26
513	0.26
514	0.26
515	0.26
516	0.24
517	0.24
518	0.25
519	0.22
520	0.21
521	0.24
522	0.29
523	0.3
524	0.3
525	0.33
526	0.34
527	0.35
528	0.39
529	0.39
530	0.39
531	0.42
532	0.47
533	0.48
534	0.48
535	0.46
536	0.4
537	0.41
538	0.4
539	0.37
540	0.29
541	0.26
542	0.28
543	0.29
544	0.29
545	0.26
546	0.21
547	0.2
548	0.22
549	0.2
550	0.15
551	0.14
552	0.13
553	0.13
554	0.14
555	0.18
556	0.18
557	0.21
558	0.24
559	0.29
560	0.36
561	0.37
562	0.43
563	0.44
564	0.47
565	0.55
566	0.61
567	0.65
568	0.63
569	0.68
570	0.7
571	0.74
572	0.78
573	0.78
574	0.78
575	0.74
576	0.76
577	0.73
578	0.66
579	0.64
580	0.61
581	0.58
582	0.49
583	0.46
584	0.45
585	0.44
586	0.45
587	0.45
588	0.42
589	0.4
590	0.39
591	0.37
592	0.34
593	0.32
594	0.29
595	0.27
596	0.26
597	0.24
598	0.25
599	0.28
600	0.33
601	0.37
602	0.35
603	0.32
604	0.33
605	0.33
606	0.33
607	0.33
608	0.31
609	0.31
610	0.32
611	0.35
612	0.31
613	0.3
614	0.3
615	0.29
616	0.29
617	0.32
618	0.31
619	0.35
620	0.35
621	0.34
622	0.35
623	0.34
624	0.36
625	0.32
626	0.38
627	0.36
628	0.46
629	0.52
630	0.51
631	0.53
632	0.54
633	0.59
634	0.57
635	0.62
636	0.62
637	0.67
638	0.74
639	0.77
640	0.79
641	0.8
642	0.81
643	0.77
644	0.74
645	0.65
646	0.56
647	0.52
648	0.46
649	0.39
650	0.33

A0A2P7YCK7

3D AlphaFold-predicted Structure Viewer