Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7RYT6

Protein Details
Accession Q7RYT6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-52VEPWLTKTLKRINKVKRPLNSVPQHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 7, cyto 6.5, cyto_nucl 5
Family & Domain DBs
KEGG ncr:NCU00373  -  
Amino Acid Sequences MPVQLLPASAAAFAPRASSVNVVLGSKVEPWLTKTLKRINKVKRPLNSVPQHTKCLTETLSSPNAIWILASLMLPKAPEDKLKNDSNPLVEAIANYQLIHLEAYIVHVDMVLRNEVAFKLTPDTIESLIEYHKDVHCPNTKASTYDWSEKDQQCKKLHDDFVQAINKFVFTTHVTALEGLEEEGAGELLDGRSEDVKSAVMNLYKPLLPPPPRIVDVVRQPPLLPSSPANVSMWSQPTTPSSLPAPVESWRVLPSSPSVASSGSASPPMWASMGVSEVQMPSPTPAYSTPSYSTPFSSAGYYYGSTLVSAPLPLPSMLAPHCGVSMGFNNFGWDRYQEYTTTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.12
5 0.14
6 0.14
7 0.17
8 0.18
9 0.17
10 0.16
11 0.16
12 0.16
13 0.15
14 0.15
15 0.13
16 0.13
17 0.16
18 0.24
19 0.28
20 0.32
21 0.39
22 0.47
23 0.53
24 0.61
25 0.67
26 0.69
27 0.75
28 0.81
29 0.81
30 0.79
31 0.81
32 0.8
33 0.81
34 0.79
35 0.78
36 0.78
37 0.74
38 0.72
39 0.64
40 0.59
41 0.49
42 0.45
43 0.37
44 0.29
45 0.27
46 0.27
47 0.29
48 0.27
49 0.26
50 0.22
51 0.21
52 0.18
53 0.16
54 0.1
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.11
64 0.11
65 0.18
66 0.22
67 0.27
68 0.32
69 0.38
70 0.4
71 0.42
72 0.43
73 0.38
74 0.35
75 0.3
76 0.25
77 0.19
78 0.17
79 0.14
80 0.13
81 0.12
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.07
88 0.05
89 0.05
90 0.06
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.09
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.09
104 0.08
105 0.08
106 0.1
107 0.11
108 0.11
109 0.11
110 0.13
111 0.12
112 0.12
113 0.11
114 0.09
115 0.09
116 0.1
117 0.09
118 0.1
119 0.11
120 0.13
121 0.13
122 0.19
123 0.26
124 0.28
125 0.29
126 0.32
127 0.32
128 0.31
129 0.32
130 0.31
131 0.28
132 0.32
133 0.32
134 0.29
135 0.37
136 0.38
137 0.46
138 0.45
139 0.5
140 0.48
141 0.5
142 0.52
143 0.51
144 0.52
145 0.46
146 0.44
147 0.38
148 0.4
149 0.41
150 0.35
151 0.29
152 0.25
153 0.22
154 0.18
155 0.16
156 0.12
157 0.08
158 0.11
159 0.1
160 0.11
161 0.11
162 0.11
163 0.11
164 0.09
165 0.07
166 0.05
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.02
173 0.02
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.06
185 0.07
186 0.09
187 0.09
188 0.09
189 0.1
190 0.11
191 0.11
192 0.12
193 0.13
194 0.19
195 0.21
196 0.24
197 0.28
198 0.3
199 0.31
200 0.33
201 0.32
202 0.3
203 0.35
204 0.39
205 0.36
206 0.33
207 0.31
208 0.31
209 0.32
210 0.28
211 0.21
212 0.15
213 0.16
214 0.17
215 0.19
216 0.18
217 0.16
218 0.16
219 0.18
220 0.19
221 0.17
222 0.16
223 0.16
224 0.17
225 0.21
226 0.2
227 0.18
228 0.17
229 0.19
230 0.2
231 0.19
232 0.2
233 0.17
234 0.2
235 0.18
236 0.18
237 0.16
238 0.16
239 0.15
240 0.14
241 0.15
242 0.16
243 0.16
244 0.16
245 0.16
246 0.15
247 0.16
248 0.16
249 0.15
250 0.12
251 0.13
252 0.12
253 0.12
254 0.12
255 0.12
256 0.1
257 0.09
258 0.09
259 0.08
260 0.09
261 0.09
262 0.08
263 0.08
264 0.09
265 0.09
266 0.09
267 0.09
268 0.09
269 0.11
270 0.11
271 0.12
272 0.13
273 0.18
274 0.2
275 0.23
276 0.24
277 0.25
278 0.28
279 0.28
280 0.28
281 0.25
282 0.25
283 0.22
284 0.21
285 0.19
286 0.17
287 0.18
288 0.17
289 0.15
290 0.14
291 0.13
292 0.12
293 0.12
294 0.12
295 0.1
296 0.1
297 0.09
298 0.09
299 0.11
300 0.1
301 0.11
302 0.1
303 0.13
304 0.14
305 0.17
306 0.16
307 0.16
308 0.16
309 0.15
310 0.15
311 0.15
312 0.2
313 0.2
314 0.21
315 0.2
316 0.24
317 0.24
318 0.25
319 0.24
320 0.19
321 0.2
322 0.23
323 0.25