Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YY57

Protein Details
Accession A0A2P7YY57    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-29EWAFGKKLTPQERLRKNQRALEKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, mito 2, plas 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0000815  C:ESCRT III complex  
GO:1904669  P:ATP export  
GO:0070676  P:intralumenal vesicle formation  
GO:0045053  P:protein retention in Golgi apparatus  
GO:0043328  P:protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MSALFEWAFGKKLTPQERLRKNQRALEKTQRELTREVNKLQSQEKTLMLEIKKLAKQGQIASAKIQAKDLVRTKNYIVKFNLMKAQLQAILLRIQSVRSNQQMGSSMRDATRLLLGMNRSMNLPQLSRIAQEFAKENDLMDQKQEFMDDAIDDAMADDEELGEDEQVDEILTKVLDEIGVDINTSLKDTPNTINVESPSKQDARVAEAIGGHGGAGGLEEDDLQARLDSLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.57
4 0.68
5 0.76
6 0.82
7 0.82
8 0.82
9 0.81
10 0.82
11 0.79
12 0.77
13 0.78
14 0.75
15 0.7
16 0.71
17 0.68
18 0.61
19 0.57
20 0.57
21 0.55
22 0.52
23 0.5
24 0.49
25 0.48
26 0.48
27 0.5
28 0.46
29 0.4
30 0.38
31 0.36
32 0.31
33 0.3
34 0.32
35 0.28
36 0.27
37 0.27
38 0.3
39 0.3
40 0.29
41 0.3
42 0.27
43 0.3
44 0.29
45 0.35
46 0.33
47 0.32
48 0.31
49 0.36
50 0.35
51 0.32
52 0.31
53 0.26
54 0.23
55 0.29
56 0.33
57 0.34
58 0.32
59 0.34
60 0.35
61 0.38
62 0.39
63 0.38
64 0.34
65 0.32
66 0.32
67 0.32
68 0.36
69 0.3
70 0.29
71 0.23
72 0.23
73 0.18
74 0.17
75 0.15
76 0.11
77 0.12
78 0.11
79 0.11
80 0.1
81 0.1
82 0.11
83 0.13
84 0.16
85 0.16
86 0.18
87 0.17
88 0.19
89 0.23
90 0.22
91 0.24
92 0.21
93 0.2
94 0.18
95 0.19
96 0.17
97 0.13
98 0.13
99 0.09
100 0.08
101 0.08
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.09
108 0.12
109 0.11
110 0.1
111 0.1
112 0.12
113 0.12
114 0.12
115 0.12
116 0.12
117 0.11
118 0.12
119 0.13
120 0.12
121 0.14
122 0.13
123 0.13
124 0.15
125 0.17
126 0.16
127 0.16
128 0.15
129 0.13
130 0.13
131 0.13
132 0.09
133 0.07
134 0.08
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.07
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.1
172 0.09
173 0.08
174 0.09
175 0.12
176 0.15
177 0.2
178 0.23
179 0.23
180 0.26
181 0.26
182 0.31
183 0.29
184 0.3
185 0.29
186 0.27
187 0.27
188 0.27
189 0.26
190 0.27
191 0.28
192 0.26
193 0.22
194 0.21
195 0.21
196 0.18
197 0.17
198 0.1
199 0.07
200 0.06
201 0.05
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.06
209 0.07
210 0.07
211 0.07
212 0.07