Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YS87

Protein Details
Accession A0A2P7YS87    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
183-203AVTSERRRKRREFKELRAQFQHydrophilic
NLS Segment(s)
PositionSequence
188-194RRRKRRE
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR036167  tRNA_intron_Endo_cat-like_sf  
IPR006677  tRNA_intron_Endonuc_cat-like  
IPR006676  tRNA_splic  
IPR016589  tRNA_splic_SEN2  
Gene Ontology GO:0000214  C:tRNA-intron endonuclease complex  
GO:0016829  F:lyase activity  
GO:0003676  F:nucleic acid binding  
GO:0000213  F:tRNA-intron endonuclease activity  
GO:0006388  P:tRNA splicing, via endonucleolytic cleavage and ligation  
Pfam View protein in Pfam  
PF01974  tRNA_int_endo  
CDD cd22363  tRNA-intron_lyase_C  
Amino Acid Sequences MSTQILHFIEKNKDQDYVDQLINKSISDSRYVSHDTTSIKINSDTWNLTSLRLENVTTFEGSKKNESYLEQMKRNRKELNQIHRNPLPVELSVDTRGELPLVNVTNGISWLWLWFRIATLYFTSPPRAPKMRISSEDPGLFALRNEGDMRRAWNNGFFGKGTLSRLEPTFGARVLGQLKSSEAVTSERRRKRREFKELRAQFQRLEAEQRKRELSTEELQKMEELKVKMEEVNTEALTFKDNEEAAGSEDLADLEFLQLDPVEAFFLAFALEAGEVLTEKSVFNDIELLQSIADLDHSQALFIHRLLSFLQRYVVYHHYRSLGWCVRSGIKFGCEYLLYKRGPPFHHAEFGILILAADETRLWEDTMAVARVIGGVKKTLIFAYVEMPTLEQVSEVWESKKAPRQKVMDLLQLYKISEMVYRRWSPSRTRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.44
4 0.41
5 0.38
6 0.38
7 0.36
8 0.37
9 0.36
10 0.3
11 0.27
12 0.26
13 0.24
14 0.24
15 0.25
16 0.21
17 0.26
18 0.31
19 0.29
20 0.27
21 0.29
22 0.27
23 0.27
24 0.33
25 0.29
26 0.26
27 0.26
28 0.27
29 0.28
30 0.3
31 0.31
32 0.25
33 0.29
34 0.27
35 0.27
36 0.27
37 0.24
38 0.23
39 0.22
40 0.21
41 0.17
42 0.2
43 0.2
44 0.19
45 0.19
46 0.18
47 0.21
48 0.24
49 0.28
50 0.27
51 0.27
52 0.29
53 0.3
54 0.35
55 0.4
56 0.45
57 0.48
58 0.55
59 0.62
60 0.66
61 0.7
62 0.69
63 0.64
64 0.66
65 0.68
66 0.71
67 0.72
68 0.71
69 0.73
70 0.69
71 0.67
72 0.57
73 0.51
74 0.42
75 0.31
76 0.29
77 0.22
78 0.22
79 0.21
80 0.21
81 0.18
82 0.16
83 0.15
84 0.12
85 0.11
86 0.09
87 0.12
88 0.12
89 0.12
90 0.12
91 0.12
92 0.12
93 0.12
94 0.11
95 0.07
96 0.05
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.1
104 0.11
105 0.11
106 0.13
107 0.15
108 0.17
109 0.18
110 0.21
111 0.22
112 0.25
113 0.3
114 0.32
115 0.32
116 0.38
117 0.45
118 0.49
119 0.51
120 0.54
121 0.52
122 0.52
123 0.5
124 0.41
125 0.34
126 0.28
127 0.23
128 0.16
129 0.15
130 0.1
131 0.1
132 0.12
133 0.11
134 0.12
135 0.14
136 0.17
137 0.17
138 0.19
139 0.18
140 0.2
141 0.22
142 0.21
143 0.21
144 0.18
145 0.16
146 0.16
147 0.17
148 0.15
149 0.14
150 0.14
151 0.14
152 0.14
153 0.15
154 0.13
155 0.14
156 0.14
157 0.12
158 0.12
159 0.1
160 0.12
161 0.13
162 0.14
163 0.12
164 0.11
165 0.11
166 0.11
167 0.11
168 0.08
169 0.07
170 0.1
171 0.15
172 0.23
173 0.33
174 0.39
175 0.47
176 0.53
177 0.61
178 0.69
179 0.74
180 0.77
181 0.77
182 0.79
183 0.83
184 0.82
185 0.8
186 0.75
187 0.66
188 0.55
189 0.49
190 0.42
191 0.31
192 0.34
193 0.34
194 0.36
195 0.37
196 0.39
197 0.37
198 0.35
199 0.35
200 0.29
201 0.27
202 0.25
203 0.29
204 0.28
205 0.27
206 0.27
207 0.26
208 0.25
209 0.22
210 0.21
211 0.14
212 0.13
213 0.14
214 0.15
215 0.15
216 0.14
217 0.13
218 0.1
219 0.12
220 0.11
221 0.1
222 0.1
223 0.09
224 0.1
225 0.1
226 0.09
227 0.09
228 0.09
229 0.09
230 0.09
231 0.09
232 0.1
233 0.09
234 0.09
235 0.06
236 0.07
237 0.06
238 0.06
239 0.05
240 0.04
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.04
265 0.04
266 0.04
267 0.05
268 0.07
269 0.07
270 0.07
271 0.09
272 0.09
273 0.1
274 0.11
275 0.11
276 0.08
277 0.08
278 0.08
279 0.06
280 0.06
281 0.05
282 0.05
283 0.07
284 0.07
285 0.07
286 0.08
287 0.1
288 0.11
289 0.11
290 0.13
291 0.11
292 0.12
293 0.13
294 0.18
295 0.17
296 0.17
297 0.19
298 0.16
299 0.17
300 0.21
301 0.27
302 0.26
303 0.27
304 0.29
305 0.28
306 0.29
307 0.3
308 0.34
309 0.33
310 0.3
311 0.3
312 0.31
313 0.34
314 0.34
315 0.36
316 0.29
317 0.25
318 0.25
319 0.23
320 0.23
321 0.18
322 0.19
323 0.21
324 0.26
325 0.24
326 0.28
327 0.31
328 0.36
329 0.37
330 0.41
331 0.42
332 0.39
333 0.43
334 0.4
335 0.37
336 0.31
337 0.28
338 0.24
339 0.17
340 0.12
341 0.07
342 0.07
343 0.05
344 0.04
345 0.04
346 0.05
347 0.07
348 0.08
349 0.08
350 0.08
351 0.08
352 0.11
353 0.14
354 0.14
355 0.12
356 0.11
357 0.11
358 0.12
359 0.13
360 0.12
361 0.1
362 0.1
363 0.12
364 0.13
365 0.14
366 0.12
367 0.13
368 0.12
369 0.12
370 0.15
371 0.15
372 0.15
373 0.14
374 0.15
375 0.14
376 0.14
377 0.13
378 0.09
379 0.07
380 0.1
381 0.13
382 0.15
383 0.16
384 0.18
385 0.21
386 0.28
387 0.37
388 0.42
389 0.47
390 0.54
391 0.59
392 0.63
393 0.7
394 0.68
395 0.68
396 0.63
397 0.57
398 0.54
399 0.5
400 0.43
401 0.34
402 0.28
403 0.21
404 0.21
405 0.21
406 0.22
407 0.29
408 0.33
409 0.38
410 0.44
411 0.48