Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YV58

Protein Details
Accession A0A2P7YV58   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40GYLWKKAPRMSQPQKQRLRRRMQLVDHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRSTLVAYGGYLWKKAPRMSQPQKQRLRRRMQLVDHNIEVLYQSLKPENEVSTGFKKIDALKFDFPKEYELLTKDKYTTFDKKVRGYRKSVHFVPKWTKKSFRDNPKNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.2
5 0.24
6 0.27
7 0.32
8 0.35
9 0.46
10 0.55
11 0.62
12 0.69
13 0.76
14 0.82
15 0.85
16 0.87
17 0.86
18 0.86
19 0.85
20 0.83
21 0.81
22 0.78
23 0.78
24 0.74
25 0.69
26 0.59
27 0.51
28 0.42
29 0.33
30 0.27
31 0.17
32 0.1
33 0.06
34 0.07
35 0.09
36 0.09
37 0.1
38 0.11
39 0.11
40 0.12
41 0.12
42 0.15
43 0.15
44 0.17
45 0.16
46 0.15
47 0.16
48 0.18
49 0.2
50 0.21
51 0.23
52 0.27
53 0.29
54 0.3
55 0.3
56 0.27
57 0.26
58 0.24
59 0.2
60 0.17
61 0.17
62 0.2
63 0.2
64 0.21
65 0.2
66 0.2
67 0.23
68 0.26
69 0.31
70 0.35
71 0.39
72 0.43
73 0.5
74 0.58
75 0.64
76 0.63
77 0.63
78 0.65
79 0.67
80 0.7
81 0.68
82 0.69
83 0.64
84 0.67
85 0.7
86 0.72
87 0.7
88 0.69
89 0.72
90 0.69
91 0.76
92 0.78
93 0.79