Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7UWK1

Protein Details
Accession A7UWK1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-142SQVLKCKKERWEHREKLRKRBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045200  CHIP  
IPR045202  CHIP_RING-Ubox  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
IPR003613  Ubox_domain  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051087  F:protein-folding chaperone binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0071218  P:cellular response to misfolded protein  
GO:0045862  P:positive regulation of proteolysis  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
GO:0000209  P:protein polyubiquitination  
GO:0006515  P:protein quality control for misfolded or incompletely synthesized proteins  
KEGG ncr:NCU10270  -  
Pfam View protein in Pfam  
PF04564  U-box  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS51698  U_BOX  
CDD cd16654  RING-Ubox_CHIP  
Amino Acid Sequences MSTQSSLALKEEGNRHFQKGDYVAAEALYTKAILADPTNPLLYTNRAMARLKMSRWDSVIEDCEECLRLSSSSSTGSKNFKALYYLSQAHLPLRNYDQAVAYALEAHKICAETHDKSLAAVTSQVLKCKKERWEHREKLRKREEQELEGEVVEMLRREMDGLLKTTSSSGGEDGDKDEEEEERKETEKMYEEKIERIRAVFERARDKENQRRPNPPDWAIDDISFQVMVDPVMTKTGKSYERASIEEHLRRSETDPLTRTPLTIKDLLPNIDLKHACEEFLNENGWAVDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.4
4 0.39
5 0.4
6 0.35
7 0.36
8 0.29
9 0.28
10 0.25
11 0.23
12 0.22
13 0.16
14 0.14
15 0.1
16 0.08
17 0.06
18 0.06
19 0.07
20 0.08
21 0.09
22 0.11
23 0.14
24 0.16
25 0.17
26 0.16
27 0.17
28 0.18
29 0.21
30 0.19
31 0.22
32 0.22
33 0.25
34 0.27
35 0.28
36 0.33
37 0.35
38 0.34
39 0.38
40 0.38
41 0.37
42 0.37
43 0.37
44 0.32
45 0.3
46 0.32
47 0.26
48 0.23
49 0.21
50 0.2
51 0.19
52 0.17
53 0.14
54 0.12
55 0.1
56 0.11
57 0.13
58 0.13
59 0.16
60 0.18
61 0.19
62 0.22
63 0.26
64 0.26
65 0.28
66 0.27
67 0.23
68 0.24
69 0.23
70 0.22
71 0.24
72 0.25
73 0.22
74 0.23
75 0.23
76 0.24
77 0.27
78 0.24
79 0.21
80 0.22
81 0.24
82 0.22
83 0.23
84 0.21
85 0.17
86 0.17
87 0.15
88 0.11
89 0.11
90 0.1
91 0.12
92 0.11
93 0.11
94 0.1
95 0.11
96 0.11
97 0.12
98 0.17
99 0.16
100 0.18
101 0.19
102 0.18
103 0.17
104 0.18
105 0.14
106 0.1
107 0.09
108 0.08
109 0.13
110 0.13
111 0.18
112 0.19
113 0.21
114 0.23
115 0.28
116 0.36
117 0.38
118 0.48
119 0.52
120 0.61
121 0.68
122 0.76
123 0.81
124 0.78
125 0.79
126 0.79
127 0.77
128 0.69
129 0.7
130 0.63
131 0.56
132 0.53
133 0.44
134 0.35
135 0.28
136 0.25
137 0.14
138 0.11
139 0.08
140 0.06
141 0.04
142 0.03
143 0.03
144 0.04
145 0.04
146 0.06
147 0.07
148 0.09
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.08
155 0.08
156 0.07
157 0.08
158 0.08
159 0.08
160 0.09
161 0.1
162 0.09
163 0.09
164 0.09
165 0.09
166 0.1
167 0.11
168 0.11
169 0.11
170 0.13
171 0.13
172 0.13
173 0.15
174 0.19
175 0.2
176 0.23
177 0.28
178 0.28
179 0.33
180 0.37
181 0.37
182 0.31
183 0.29
184 0.29
185 0.24
186 0.3
187 0.27
188 0.27
189 0.34
190 0.36
191 0.39
192 0.42
193 0.49
194 0.52
195 0.6
196 0.66
197 0.62
198 0.69
199 0.72
200 0.74
201 0.73
202 0.67
203 0.61
204 0.55
205 0.55
206 0.46
207 0.41
208 0.33
209 0.26
210 0.23
211 0.17
212 0.13
213 0.08
214 0.07
215 0.06
216 0.06
217 0.06
218 0.06
219 0.1
220 0.11
221 0.1
222 0.12
223 0.18
224 0.21
225 0.23
226 0.27
227 0.3
228 0.34
229 0.35
230 0.37
231 0.37
232 0.42
233 0.44
234 0.43
235 0.39
236 0.37
237 0.37
238 0.37
239 0.4
240 0.36
241 0.38
242 0.39
243 0.39
244 0.44
245 0.43
246 0.4
247 0.35
248 0.34
249 0.32
250 0.33
251 0.31
252 0.31
253 0.35
254 0.36
255 0.34
256 0.33
257 0.29
258 0.33
259 0.33
260 0.28
261 0.32
262 0.3
263 0.29
264 0.26
265 0.29
266 0.24
267 0.26
268 0.25
269 0.18
270 0.18