Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YTM3

Protein Details
Accession A0A2P7YTM3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41YFYNPNKKTFKAPKKCLGCYNNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, mito 6, pero 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008928  6-hairpin_glycosidase_sf  
IPR005198  Glyco_hydro_76  
Gene Ontology GO:0016798  F:hydrolase activity, acting on glycosyl bonds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF03663  Glyco_hydro_76  
Amino Acid Sequences MSLTNPNLEGYAITRGMWLYFYNPNKKTFKAPKKCLGCYNNDTFVVWAVSVAAQAIVDGARIYPELKPLIGPAIDTFQRYKNNHTKGFSAAENGGNDTDIYYDDDAQVASAMLTAYEVTGEKRFLDQGRELTRFLMGGWHPKIGGIKWHVSKTYVNACTTAEVAKACLQCSKFIPDEAQTYIDFAAKCIQWQIDTLQDKNDKCIIDGVQPDGMKFENGKLTYNTGTTLSCAAHLWHITKDEKWKNIADDLAKASIDHNVPFFDRDYPMELRYWRDPNYWTQLLIEGLADYLLYVGNDAPEGLPKAIHDEVLRNILMYYKYAKDPQDGLYIQTFEPHGTFPEKADLYKEEFQGKKKVGFKGEDSDGGKPQKCLMGLGAAARCFFQAARIIPEIHYNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.16
5 0.15
6 0.13
7 0.21
8 0.3
9 0.38
10 0.41
11 0.49
12 0.52
13 0.54
14 0.6
15 0.63
16 0.66
17 0.67
18 0.73
19 0.76
20 0.81
21 0.84
22 0.83
23 0.79
24 0.76
25 0.73
26 0.71
27 0.66
28 0.58
29 0.52
30 0.43
31 0.38
32 0.29
33 0.21
34 0.14
35 0.09
36 0.09
37 0.08
38 0.08
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.05
46 0.04
47 0.05
48 0.06
49 0.07
50 0.08
51 0.12
52 0.13
53 0.14
54 0.14
55 0.14
56 0.17
57 0.16
58 0.16
59 0.13
60 0.17
61 0.18
62 0.19
63 0.21
64 0.23
65 0.31
66 0.32
67 0.41
68 0.46
69 0.53
70 0.58
71 0.58
72 0.55
73 0.5
74 0.52
75 0.43
76 0.37
77 0.3
78 0.27
79 0.25
80 0.24
81 0.2
82 0.16
83 0.16
84 0.12
85 0.1
86 0.08
87 0.09
88 0.09
89 0.09
90 0.09
91 0.1
92 0.09
93 0.09
94 0.08
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.08
107 0.09
108 0.09
109 0.1
110 0.14
111 0.15
112 0.19
113 0.2
114 0.25
115 0.31
116 0.33
117 0.32
118 0.3
119 0.28
120 0.24
121 0.21
122 0.19
123 0.14
124 0.19
125 0.2
126 0.2
127 0.2
128 0.21
129 0.22
130 0.17
131 0.22
132 0.18
133 0.23
134 0.26
135 0.28
136 0.28
137 0.29
138 0.29
139 0.28
140 0.33
141 0.3
142 0.27
143 0.26
144 0.26
145 0.24
146 0.24
147 0.2
148 0.12
149 0.09
150 0.09
151 0.13
152 0.14
153 0.13
154 0.16
155 0.16
156 0.17
157 0.19
158 0.22
159 0.18
160 0.18
161 0.19
162 0.18
163 0.19
164 0.19
165 0.18
166 0.14
167 0.14
168 0.14
169 0.14
170 0.12
171 0.1
172 0.13
173 0.11
174 0.11
175 0.12
176 0.11
177 0.09
178 0.1
179 0.11
180 0.15
181 0.17
182 0.17
183 0.21
184 0.25
185 0.25
186 0.26
187 0.29
188 0.22
189 0.2
190 0.22
191 0.18
192 0.17
193 0.18
194 0.17
195 0.17
196 0.17
197 0.16
198 0.15
199 0.14
200 0.1
201 0.1
202 0.1
203 0.12
204 0.12
205 0.14
206 0.14
207 0.16
208 0.17
209 0.17
210 0.16
211 0.12
212 0.12
213 0.11
214 0.12
215 0.09
216 0.09
217 0.09
218 0.08
219 0.09
220 0.1
221 0.11
222 0.11
223 0.14
224 0.15
225 0.17
226 0.26
227 0.3
228 0.32
229 0.33
230 0.34
231 0.33
232 0.33
233 0.34
234 0.26
235 0.23
236 0.22
237 0.2
238 0.18
239 0.16
240 0.14
241 0.15
242 0.15
243 0.13
244 0.12
245 0.12
246 0.12
247 0.14
248 0.14
249 0.12
250 0.13
251 0.14
252 0.18
253 0.19
254 0.19
255 0.21
256 0.21
257 0.23
258 0.28
259 0.31
260 0.28
261 0.29
262 0.3
263 0.33
264 0.4
265 0.37
266 0.32
267 0.28
268 0.27
269 0.24
270 0.22
271 0.16
272 0.08
273 0.07
274 0.06
275 0.05
276 0.04
277 0.04
278 0.03
279 0.03
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.05
286 0.07
287 0.09
288 0.09
289 0.09
290 0.09
291 0.14
292 0.14
293 0.16
294 0.15
295 0.16
296 0.18
297 0.22
298 0.21
299 0.16
300 0.16
301 0.17
302 0.17
303 0.16
304 0.17
305 0.17
306 0.2
307 0.25
308 0.27
309 0.27
310 0.29
311 0.31
312 0.35
313 0.32
314 0.32
315 0.3
316 0.3
317 0.26
318 0.26
319 0.24
320 0.16
321 0.17
322 0.15
323 0.14
324 0.16
325 0.17
326 0.16
327 0.23
328 0.23
329 0.23
330 0.26
331 0.26
332 0.3
333 0.34
334 0.36
335 0.37
336 0.4
337 0.44
338 0.49
339 0.49
340 0.5
341 0.52
342 0.56
343 0.54
344 0.55
345 0.55
346 0.54
347 0.54
348 0.53
349 0.49
350 0.46
351 0.46
352 0.48
353 0.46
354 0.39
355 0.38
356 0.35
357 0.33
358 0.31
359 0.26
360 0.23
361 0.22
362 0.27
363 0.28
364 0.24
365 0.24
366 0.23
367 0.21
368 0.18
369 0.16
370 0.14
371 0.18
372 0.2
373 0.25
374 0.28
375 0.3
376 0.29
377 0.38