Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YTZ9

Protein Details
Accession A0A2P7YTZ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
162-188KVKSQTPKVDKQEKPKQPKGRAYMRLLHydrophilic
NLS Segment(s)
PositionSequence
175-178KPKQ
Subcellular Location(s) mito 10, E.R. 7, plas 4, vacu 3, extr 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR003807  DUF202  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0005774  C:vacuolar membrane  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF02656  DUF202  
PF04758  Ribosomal_S30  
Amino Acid Sequences MSETEPLLGTPKNAWGLVLIPNQGAVARDHMANERTFLAWLRTSLSLTTIGIGVVQLFKLQLKGEYDEMAKFGKPIGAGFFFLGILCLLFGCYRFFNVQGLLLEQKYPISYFSVLLLVASVFVLVFATVVVVFTQLSKFHETSNSLLTAQGKVHGSLARAGKVKSQTPKVDKQEKPKQPKGRAYMRLLYTKRFVNVTLVNGKRKANSNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.18
4 0.23
5 0.24
6 0.21
7 0.18
8 0.18
9 0.18
10 0.18
11 0.17
12 0.12
13 0.12
14 0.12
15 0.13
16 0.14
17 0.18
18 0.21
19 0.2
20 0.2
21 0.18
22 0.17
23 0.18
24 0.17
25 0.17
26 0.15
27 0.15
28 0.17
29 0.16
30 0.17
31 0.16
32 0.16
33 0.14
34 0.13
35 0.12
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.07
47 0.07
48 0.09
49 0.11
50 0.14
51 0.14
52 0.16
53 0.17
54 0.16
55 0.16
56 0.15
57 0.13
58 0.1
59 0.1
60 0.09
61 0.08
62 0.08
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.09
69 0.09
70 0.09
71 0.06
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.06
80 0.07
81 0.08
82 0.09
83 0.09
84 0.09
85 0.1
86 0.09
87 0.1
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.07
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.07
104 0.05
105 0.04
106 0.04
107 0.03
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.05
122 0.06
123 0.08
124 0.12
125 0.13
126 0.13
127 0.17
128 0.19
129 0.2
130 0.22
131 0.21
132 0.17
133 0.18
134 0.18
135 0.16
136 0.14
137 0.16
138 0.14
139 0.13
140 0.15
141 0.16
142 0.15
143 0.19
144 0.21
145 0.22
146 0.24
147 0.24
148 0.27
149 0.29
150 0.35
151 0.37
152 0.43
153 0.48
154 0.52
155 0.61
156 0.66
157 0.72
158 0.71
159 0.74
160 0.77
161 0.79
162 0.82
163 0.83
164 0.83
165 0.83
166 0.86
167 0.84
168 0.83
169 0.82
170 0.78
171 0.76
172 0.71
173 0.71
174 0.64
175 0.6
176 0.54
177 0.49
178 0.45
179 0.38
180 0.34
181 0.31
182 0.33
183 0.34
184 0.4
185 0.42
186 0.45
187 0.48
188 0.49
189 0.47
190 0.51