Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YSW5

Protein Details
Accession A0A2P7YSW5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
408-427PLIRLCLEQGKQRRRRGRKKBasic
NLS Segment(s)
PositionSequence
188-191RIKK
418-427KQRRRRGRKK
Subcellular Location(s) E.R. 9, cyto 4.5, cyto_nucl 4.5, extr 4, golg 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010255  Haem_peroxidase_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0004601  F:peroxidase activity  
GO:0006979  P:response to oxidative stress  
Amino Acid Sequences MLVELGAIAVAPLVTVQCVLLKSTKLALSVFWYLCWFLHPFAITRRIPEDPMEGMEFVVEVSTFKFSQIPLKAYYVSKRYLFEDPQDTGFNGIPLSETEGFSDYLMKLESYARAYHTVEVIEGYEDSDSEESIEEEQNDQESGNPQTLNGTSTLDEASVFDPHDVSSKASSSSSVSETSYCEAAKKLRIKKRDRILNKMVANYPPVLTANRFKHLRIAIEKYIETLGFPKHLFLKLCWQYFSWGGTDIDMMYLEPELEVCFLWMEVLREDFPISSADMWTFTAKVVLELLGASKIPWTGGRFDTMPFIKASFGELCSRFNLSLREQVALWGGVQILGFLDFMEIEPSQSNIYLEEMPGYKDLTPRARQLLDLFGAKGPDIAGDFCEDHNLLIREFGHAYGKMIEQTNPLIRLCLEQGKQRRRRGRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.08
5 0.09
6 0.11
7 0.14
8 0.15
9 0.17
10 0.22
11 0.23
12 0.22
13 0.22
14 0.21
15 0.23
16 0.28
17 0.27
18 0.23
19 0.22
20 0.22
21 0.21
22 0.23
23 0.2
24 0.14
25 0.17
26 0.18
27 0.19
28 0.24
29 0.33
30 0.31
31 0.32
32 0.36
33 0.35
34 0.35
35 0.35
36 0.33
37 0.26
38 0.29
39 0.27
40 0.23
41 0.2
42 0.18
43 0.15
44 0.11
45 0.09
46 0.06
47 0.04
48 0.05
49 0.09
50 0.09
51 0.1
52 0.11
53 0.12
54 0.2
55 0.25
56 0.27
57 0.27
58 0.3
59 0.33
60 0.34
61 0.4
62 0.36
63 0.36
64 0.36
65 0.35
66 0.36
67 0.39
68 0.38
69 0.37
70 0.39
71 0.36
72 0.36
73 0.36
74 0.32
75 0.28
76 0.25
77 0.2
78 0.14
79 0.12
80 0.1
81 0.08
82 0.14
83 0.13
84 0.13
85 0.14
86 0.16
87 0.16
88 0.15
89 0.17
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.11
96 0.13
97 0.13
98 0.14
99 0.15
100 0.18
101 0.19
102 0.2
103 0.19
104 0.17
105 0.15
106 0.14
107 0.12
108 0.09
109 0.08
110 0.07
111 0.06
112 0.06
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.08
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.1
126 0.09
127 0.09
128 0.1
129 0.11
130 0.12
131 0.12
132 0.11
133 0.13
134 0.13
135 0.13
136 0.11
137 0.11
138 0.09
139 0.1
140 0.11
141 0.09
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.1
151 0.1
152 0.1
153 0.1
154 0.11
155 0.12
156 0.12
157 0.12
158 0.11
159 0.12
160 0.13
161 0.13
162 0.13
163 0.12
164 0.13
165 0.14
166 0.13
167 0.11
168 0.1
169 0.11
170 0.13
171 0.19
172 0.26
173 0.34
174 0.39
175 0.49
176 0.56
177 0.63
178 0.7
179 0.73
180 0.71
181 0.7
182 0.71
183 0.69
184 0.64
185 0.59
186 0.52
187 0.42
188 0.38
189 0.3
190 0.23
191 0.16
192 0.14
193 0.12
194 0.12
195 0.18
196 0.19
197 0.24
198 0.25
199 0.24
200 0.29
201 0.3
202 0.32
203 0.29
204 0.32
205 0.28
206 0.29
207 0.29
208 0.25
209 0.23
210 0.19
211 0.15
212 0.11
213 0.1
214 0.1
215 0.1
216 0.1
217 0.12
218 0.15
219 0.16
220 0.15
221 0.24
222 0.28
223 0.29
224 0.3
225 0.28
226 0.27
227 0.27
228 0.27
229 0.18
230 0.14
231 0.13
232 0.12
233 0.12
234 0.09
235 0.08
236 0.07
237 0.06
238 0.04
239 0.04
240 0.04
241 0.03
242 0.03
243 0.03
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.05
251 0.06
252 0.06
253 0.08
254 0.08
255 0.08
256 0.09
257 0.08
258 0.08
259 0.08
260 0.08
261 0.07
262 0.07
263 0.07
264 0.08
265 0.09
266 0.09
267 0.08
268 0.08
269 0.09
270 0.09
271 0.09
272 0.08
273 0.07
274 0.07
275 0.06
276 0.07
277 0.06
278 0.06
279 0.05
280 0.05
281 0.05
282 0.06
283 0.09
284 0.1
285 0.13
286 0.14
287 0.17
288 0.17
289 0.17
290 0.23
291 0.22
292 0.21
293 0.18
294 0.18
295 0.16
296 0.15
297 0.18
298 0.13
299 0.14
300 0.18
301 0.19
302 0.2
303 0.21
304 0.23
305 0.2
306 0.21
307 0.23
308 0.2
309 0.26
310 0.25
311 0.25
312 0.23
313 0.24
314 0.23
315 0.19
316 0.16
317 0.1
318 0.09
319 0.08
320 0.08
321 0.07
322 0.05
323 0.06
324 0.05
325 0.05
326 0.05
327 0.04
328 0.05
329 0.07
330 0.07
331 0.08
332 0.08
333 0.09
334 0.1
335 0.1
336 0.1
337 0.09
338 0.11
339 0.11
340 0.11
341 0.13
342 0.13
343 0.14
344 0.14
345 0.15
346 0.14
347 0.16
348 0.22
349 0.27
350 0.31
351 0.35
352 0.4
353 0.39
354 0.4
355 0.39
356 0.39
357 0.34
358 0.32
359 0.28
360 0.23
361 0.23
362 0.21
363 0.19
364 0.13
365 0.11
366 0.11
367 0.1
368 0.09
369 0.12
370 0.13
371 0.13
372 0.16
373 0.15
374 0.14
375 0.2
376 0.21
377 0.18
378 0.2
379 0.2
380 0.2
381 0.2
382 0.22
383 0.2
384 0.19
385 0.2
386 0.2
387 0.21
388 0.22
389 0.23
390 0.24
391 0.22
392 0.27
393 0.31
394 0.31
395 0.3
396 0.27
397 0.26
398 0.27
399 0.29
400 0.32
401 0.3
402 0.36
403 0.46
404 0.56
405 0.65
406 0.72
407 0.79