Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7YU16

Protein Details
Accession A0A2P7YU16    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
121-149APPPQNSRPSQPRNKKQHAKLKRTCSYCDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.333, mito_nucl 9.333, cyto 7.5, mito 5.5
Family & Domain DBs
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MLVVDLLTTVGQLASVITQKTKELDKLKAEYEAKIQILDKYIAKVTENVPETDSPNKTEAADLLQKELRCQNCLHLIYSLKEQSDYVLVPRQIALEKGAQVPELLQSLEQLQLGSENANPAPPPQNSRPSQPRNKKQHAKLKRTCSYCDEPGHTRARCLARLNGEPPKAQSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.09
3 0.1
4 0.11
5 0.12
6 0.14
7 0.17
8 0.2
9 0.26
10 0.28
11 0.35
12 0.4
13 0.42
14 0.43
15 0.48
16 0.46
17 0.4
18 0.38
19 0.36
20 0.3
21 0.28
22 0.27
23 0.21
24 0.22
25 0.23
26 0.2
27 0.17
28 0.18
29 0.18
30 0.18
31 0.18
32 0.17
33 0.22
34 0.23
35 0.21
36 0.21
37 0.22
38 0.24
39 0.27
40 0.27
41 0.22
42 0.21
43 0.21
44 0.2
45 0.19
46 0.17
47 0.15
48 0.18
49 0.16
50 0.18
51 0.2
52 0.2
53 0.21
54 0.26
55 0.22
56 0.2
57 0.2
58 0.2
59 0.25
60 0.26
61 0.25
62 0.23
63 0.23
64 0.22
65 0.25
66 0.24
67 0.16
68 0.15
69 0.14
70 0.12
71 0.12
72 0.11
73 0.09
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.11
80 0.11
81 0.11
82 0.09
83 0.1
84 0.11
85 0.11
86 0.1
87 0.1
88 0.1
89 0.09
90 0.08
91 0.07
92 0.06
93 0.06
94 0.07
95 0.08
96 0.07
97 0.06
98 0.05
99 0.06
100 0.07
101 0.07
102 0.06
103 0.07
104 0.07
105 0.08
106 0.08
107 0.09
108 0.15
109 0.16
110 0.22
111 0.26
112 0.35
113 0.36
114 0.45
115 0.53
116 0.58
117 0.67
118 0.72
119 0.77
120 0.79
121 0.87
122 0.89
123 0.89
124 0.9
125 0.9
126 0.9
127 0.89
128 0.88
129 0.86
130 0.8
131 0.75
132 0.71
133 0.68
134 0.64
135 0.61
136 0.56
137 0.52
138 0.55
139 0.59
140 0.52
141 0.46
142 0.47
143 0.46
144 0.45
145 0.45
146 0.45
147 0.44
148 0.5
149 0.55
150 0.56
151 0.54
152 0.51