Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YRN7

Protein Details
Accession A0A2P7YRN7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
136-158ILEARPTYRKRLAKREKNKRTWFHydrophilic
NLS Segment(s)
PositionSequence
144-155RKRLAKREKNKR
Subcellular Location(s) mito_nucl 12.833, nucl 12.5, mito 11, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSHLTAKEAFSKLPQKLHNFFIKFPPRPFAQYAEKPSTIKDPTMNPFLPNKNPETGRWHGAKYSLRRSADLIKMARKFGIQDLLPPLPNKKFYEDKYNQKNWMRGILRQKGQKWERTLPEKLEARKKAIEDMDNIILEARPTYRKRLAKREKNKRTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.51
4 0.57
5 0.59
6 0.54
7 0.52
8 0.55
9 0.58
10 0.56
11 0.54
12 0.53
13 0.47
14 0.48
15 0.49
16 0.45
17 0.44
18 0.46
19 0.51
20 0.52
21 0.51
22 0.47
23 0.46
24 0.46
25 0.39
26 0.33
27 0.29
28 0.28
29 0.3
30 0.37
31 0.36
32 0.31
33 0.35
34 0.38
35 0.4
36 0.37
37 0.36
38 0.34
39 0.35
40 0.36
41 0.37
42 0.36
43 0.35
44 0.34
45 0.32
46 0.28
47 0.32
48 0.35
49 0.34
50 0.39
51 0.41
52 0.39
53 0.39
54 0.41
55 0.42
56 0.39
57 0.38
58 0.33
59 0.32
60 0.32
61 0.32
62 0.3
63 0.24
64 0.21
65 0.17
66 0.19
67 0.13
68 0.13
69 0.17
70 0.18
71 0.19
72 0.18
73 0.2
74 0.18
75 0.22
76 0.21
77 0.22
78 0.26
79 0.28
80 0.38
81 0.42
82 0.5
83 0.55
84 0.59
85 0.62
86 0.61
87 0.62
88 0.53
89 0.55
90 0.47
91 0.44
92 0.48
93 0.49
94 0.5
95 0.53
96 0.55
97 0.56
98 0.59
99 0.6
100 0.58
101 0.58
102 0.6
103 0.6
104 0.61
105 0.54
106 0.57
107 0.56
108 0.56
109 0.58
110 0.54
111 0.52
112 0.52
113 0.5
114 0.47
115 0.46
116 0.42
117 0.36
118 0.37
119 0.35
120 0.31
121 0.3
122 0.24
123 0.2
124 0.17
125 0.15
126 0.13
127 0.17
128 0.19
129 0.27
130 0.36
131 0.44
132 0.53
133 0.63
134 0.72
135 0.75
136 0.84
137 0.88
138 0.9