Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P511

Protein Details
Accession A0A2T2P511   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRNVKKSVQKKKHVDEQAAMHydrophilic
53-78SPPNTPCHHHRHHRQRGKKKCPGPSPBasic
NLS Segment(s)
PositionSequence
66-72RQRGKKK
Subcellular Location(s) mito 17.5, cyto_mito 10, nucl 7
Family & Domain DBs
Amino Acid Sequences MRNVKKSVQKKKHVDEQAAMYAAPWPMAPSHPQANNPEPLTPFAPPAHPIDPSPPNTPCHHHRHHRQRGKKKCPGPSPARHFSLAAPHCTALHCIAHGTSHRIRIPPSPSKTHPVHIDEQSVEQKRRLTNKAGSNARANGNGDGDGDGGGDLRLASKPAHLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.69
4 0.63
5 0.54
6 0.45
7 0.35
8 0.29
9 0.24
10 0.19
11 0.13
12 0.09
13 0.09
14 0.11
15 0.14
16 0.16
17 0.23
18 0.25
19 0.3
20 0.35
21 0.39
22 0.43
23 0.41
24 0.39
25 0.34
26 0.34
27 0.31
28 0.26
29 0.24
30 0.19
31 0.19
32 0.18
33 0.22
34 0.2
35 0.19
36 0.19
37 0.22
38 0.27
39 0.29
40 0.32
41 0.3
42 0.31
43 0.33
44 0.37
45 0.38
46 0.41
47 0.45
48 0.5
49 0.58
50 0.66
51 0.75
52 0.8
53 0.83
54 0.86
55 0.89
56 0.9
57 0.89
58 0.84
59 0.82
60 0.8
61 0.78
62 0.76
63 0.75
64 0.73
65 0.69
66 0.65
67 0.56
68 0.49
69 0.41
70 0.41
71 0.33
72 0.27
73 0.22
74 0.2
75 0.19
76 0.19
77 0.2
78 0.12
79 0.11
80 0.09
81 0.08
82 0.08
83 0.09
84 0.1
85 0.15
86 0.15
87 0.2
88 0.22
89 0.23
90 0.25
91 0.29
92 0.35
93 0.39
94 0.42
95 0.43
96 0.44
97 0.5
98 0.51
99 0.5
100 0.48
101 0.44
102 0.45
103 0.4
104 0.41
105 0.34
106 0.36
107 0.39
108 0.39
109 0.36
110 0.33
111 0.35
112 0.37
113 0.43
114 0.44
115 0.43
116 0.45
117 0.52
118 0.59
119 0.61
120 0.59
121 0.57
122 0.57
123 0.53
124 0.48
125 0.42
126 0.34
127 0.29
128 0.26
129 0.21
130 0.18
131 0.15
132 0.12
133 0.1
134 0.08
135 0.06
136 0.06
137 0.05
138 0.04
139 0.06
140 0.06
141 0.08
142 0.08