Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1DZ85

Protein Details
Accession A0A0D1DZ85   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSSKGKPTDPKKREEAKKEBasic
99-132DGAKSESKEKSKKPRTKKEPKPATKGTREQPKRGBasic
NLS Segment(s)
PositionSequence
11-19PKKREEAKK
69-135PKKEAINKGERKDPSEAVGTPKKRKADAKDDGAKSESKEKSKKPRTKKEPKPATKGTREQPKRGAKK
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
KEGG uma:UMAG_02901  -  
Amino Acid Sequences MPSSKGKPTDPKKREEAKKEVLNMEKGGGKGQWSAWKAAEMSKRYEAKGGTYQDTGDNPNQAKTGAPTPKKEAINKGERKDPSEAVGTPKKRKADAKDDGAKSESKEKSKKPRTKKEPKPATKGTREQPKRGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.76
5 0.77
6 0.76
7 0.73
8 0.67
9 0.6
10 0.52
11 0.45
12 0.38
13 0.31
14 0.27
15 0.21
16 0.17
17 0.15
18 0.17
19 0.22
20 0.21
21 0.23
22 0.22
23 0.23
24 0.22
25 0.27
26 0.31
27 0.26
28 0.29
29 0.34
30 0.36
31 0.34
32 0.37
33 0.31
34 0.29
35 0.33
36 0.31
37 0.27
38 0.25
39 0.25
40 0.24
41 0.24
42 0.23
43 0.17
44 0.18
45 0.16
46 0.17
47 0.16
48 0.15
49 0.14
50 0.12
51 0.18
52 0.22
53 0.24
54 0.25
55 0.3
56 0.37
57 0.39
58 0.4
59 0.4
60 0.4
61 0.48
62 0.52
63 0.5
64 0.5
65 0.48
66 0.49
67 0.46
68 0.39
69 0.31
70 0.28
71 0.26
72 0.26
73 0.32
74 0.34
75 0.37
76 0.41
77 0.42
78 0.43
79 0.49
80 0.5
81 0.53
82 0.55
83 0.58
84 0.63
85 0.62
86 0.59
87 0.54
88 0.48
89 0.4
90 0.41
91 0.37
92 0.36
93 0.42
94 0.49
95 0.58
96 0.68
97 0.75
98 0.77
99 0.83
100 0.87
101 0.9
102 0.93
103 0.93
104 0.93
105 0.93
106 0.92
107 0.91
108 0.89
109 0.88
110 0.85
111 0.83
112 0.83
113 0.81
114 0.79
115 0.78