Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NUW5

Protein Details
Accession A0A2T2NUW5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-46AKNRCAAAPRKHCHRRPGKFHPFPPISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MRETASLPSTLPCILLETSAKNRCAAAPRKHCHRRPGKFHPFPPISAYVLPWPSSQPASQPAASESMPNAGTRCPRLTHLDATSVTSIVQTPLISHGMAWGEEGVAPAHRHSGSPDDSRPDFESWAPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.18
5 0.26
6 0.31
7 0.32
8 0.3
9 0.3
10 0.31
11 0.38
12 0.43
13 0.45
14 0.5
15 0.56
16 0.66
17 0.75
18 0.78
19 0.8
20 0.81
21 0.81
22 0.8
23 0.84
24 0.85
25 0.83
26 0.81
27 0.8
28 0.72
29 0.63
30 0.57
31 0.48
32 0.39
33 0.31
34 0.29
35 0.22
36 0.21
37 0.21
38 0.17
39 0.15
40 0.14
41 0.15
42 0.14
43 0.13
44 0.15
45 0.17
46 0.17
47 0.17
48 0.16
49 0.17
50 0.17
51 0.15
52 0.11
53 0.1
54 0.1
55 0.1
56 0.1
57 0.09
58 0.11
59 0.13
60 0.15
61 0.14
62 0.16
63 0.22
64 0.25
65 0.27
66 0.27
67 0.28
68 0.27
69 0.28
70 0.26
71 0.2
72 0.17
73 0.13
74 0.11
75 0.08
76 0.09
77 0.06
78 0.06
79 0.08
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.1
86 0.1
87 0.08
88 0.07
89 0.07
90 0.08
91 0.07
92 0.08
93 0.09
94 0.09
95 0.13
96 0.13
97 0.14
98 0.15
99 0.21
100 0.24
101 0.3
102 0.33
103 0.36
104 0.37
105 0.41
106 0.42
107 0.38
108 0.35
109 0.31
110 0.37