Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NJQ6

Protein Details
Accession A0A2T2NJQ6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-94EHTRRAQQQRQQQQQPRRVRRYVPRPVAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6, plas 6, pero 2
Family & Domain DBs
Amino Acid Sequences MLGLVVLLLLVLVLVLALLVQPPPPPCRPATTWRRHSRCCHAHGPVPPRGKKNTSAVQRYAVPCAAEHTRRAQQQRQQQQQPRRVRRYVPRPVAHDARCCTLHVASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.01
2 0.01
3 0.01
4 0.02
5 0.02
6 0.03
7 0.04
8 0.06
9 0.09
10 0.14
11 0.17
12 0.2
13 0.21
14 0.27
15 0.31
16 0.39
17 0.47
18 0.53
19 0.61
20 0.69
21 0.74
22 0.75
23 0.76
24 0.77
25 0.74
26 0.7
27 0.66
28 0.59
29 0.58
30 0.58
31 0.57
32 0.54
33 0.54
34 0.52
35 0.49
36 0.5
37 0.47
38 0.44
39 0.45
40 0.45
41 0.44
42 0.45
43 0.43
44 0.41
45 0.43
46 0.4
47 0.36
48 0.29
49 0.22
50 0.17
51 0.18
52 0.2
53 0.18
54 0.18
55 0.22
56 0.26
57 0.32
58 0.38
59 0.42
60 0.44
61 0.53
62 0.62
63 0.67
64 0.71
65 0.75
66 0.78
67 0.81
68 0.85
69 0.85
70 0.83
71 0.78
72 0.77
73 0.78
74 0.79
75 0.81
76 0.8
77 0.76
78 0.73
79 0.75
80 0.76
81 0.7
82 0.67
83 0.6
84 0.55
85 0.5
86 0.46
87 0.41