Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NG69

Protein Details
Accession A0A2T2NG69   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-50HACRNDATYHQPRKRRQHPPTPDKPYSPKHKRRKHSTAPSSHHQPBasic
NLS Segment(s)
PositionSequence
18-40RKRRQHPPTPDKPYSPKHKRRKH
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
Amino Acid Sequences MTTGIHACRNDATYHQPRKRRQHPPTPDKPYSPKHKRRKHSTAPSSHHQPCHVGLQHSCPGYPTSSTFPPSRLQISSLFRTLGPWVLRRDVIGWRIACREGAFCEAGRGLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.59
4 0.67
5 0.76
6 0.83
7 0.85
8 0.84
9 0.84
10 0.88
11 0.9
12 0.91
13 0.9
14 0.84
15 0.79
16 0.76
17 0.74
18 0.74
19 0.74
20 0.74
21 0.75
22 0.8
23 0.84
24 0.87
25 0.89
26 0.89
27 0.89
28 0.88
29 0.87
30 0.84
31 0.8
32 0.78
33 0.72
34 0.63
35 0.52
36 0.44
37 0.36
38 0.36
39 0.31
40 0.25
41 0.21
42 0.24
43 0.27
44 0.25
45 0.23
46 0.18
47 0.16
48 0.15
49 0.16
50 0.13
51 0.14
52 0.16
53 0.19
54 0.19
55 0.2
56 0.21
57 0.23
58 0.23
59 0.2
60 0.2
61 0.23
62 0.28
63 0.29
64 0.28
65 0.27
66 0.23
67 0.24
68 0.23
69 0.22
70 0.2
71 0.21
72 0.23
73 0.25
74 0.25
75 0.24
76 0.26
77 0.25
78 0.25
79 0.27
80 0.25
81 0.25
82 0.28
83 0.28
84 0.27
85 0.23
86 0.23
87 0.2
88 0.22
89 0.22
90 0.19
91 0.21
92 0.2