Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NEN9

Protein Details
Accession A0A2T2NEN9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-118YVKACHKRRGQKDGRRSVNKBasic
165-186FLVHRKDKFQKHAQKSHPNLDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences SLNHNQTKAIRKWLDTVEDIDTYFYKDYEKVRALATLVEAQPDAVLEYIRKHFRHRPAKFAQPPQTLYSPTAHQFTARYSLRNINSHLNPGDLSLVENYVKACHKRRGQKDGRRSVNKGPYRCTFDNCGYQTKRVFDWRRHEENHEPQELWLCNACPRSDGQNPFLVHRKDKFQKHAQKSHPNLDPIEVLDSSKLDFKGDFDSHCPLCSYSAFTSWDERCQHIVMHFENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.44
3 0.43
4 0.36
5 0.33
6 0.31
7 0.27
8 0.22
9 0.19
10 0.18
11 0.15
12 0.13
13 0.16
14 0.18
15 0.24
16 0.27
17 0.26
18 0.26
19 0.28
20 0.26
21 0.24
22 0.24
23 0.21
24 0.19
25 0.18
26 0.17
27 0.15
28 0.14
29 0.13
30 0.11
31 0.06
32 0.06
33 0.06
34 0.1
35 0.16
36 0.23
37 0.24
38 0.3
39 0.38
40 0.48
41 0.58
42 0.58
43 0.61
44 0.62
45 0.71
46 0.73
47 0.75
48 0.74
49 0.68
50 0.68
51 0.62
52 0.58
53 0.49
54 0.42
55 0.35
56 0.28
57 0.25
58 0.24
59 0.2
60 0.18
61 0.17
62 0.17
63 0.23
64 0.21
65 0.21
66 0.22
67 0.29
68 0.32
69 0.34
70 0.35
71 0.34
72 0.33
73 0.36
74 0.33
75 0.27
76 0.23
77 0.2
78 0.18
79 0.11
80 0.11
81 0.07
82 0.08
83 0.07
84 0.07
85 0.07
86 0.08
87 0.11
88 0.14
89 0.19
90 0.26
91 0.33
92 0.42
93 0.49
94 0.58
95 0.66
96 0.71
97 0.76
98 0.78
99 0.81
100 0.77
101 0.74
102 0.7
103 0.69
104 0.66
105 0.58
106 0.53
107 0.48
108 0.5
109 0.48
110 0.43
111 0.38
112 0.36
113 0.41
114 0.38
115 0.41
116 0.35
117 0.37
118 0.37
119 0.34
120 0.33
121 0.35
122 0.38
123 0.38
124 0.46
125 0.51
126 0.56
127 0.56
128 0.6
129 0.59
130 0.64
131 0.62
132 0.55
133 0.47
134 0.4
135 0.43
136 0.37
137 0.3
138 0.22
139 0.16
140 0.17
141 0.19
142 0.19
143 0.14
144 0.15
145 0.21
146 0.27
147 0.3
148 0.29
149 0.34
150 0.35
151 0.37
152 0.43
153 0.4
154 0.37
155 0.36
156 0.43
157 0.45
158 0.51
159 0.57
160 0.59
161 0.67
162 0.72
163 0.79
164 0.79
165 0.82
166 0.81
167 0.81
168 0.76
169 0.69
170 0.6
171 0.52
172 0.44
173 0.34
174 0.31
175 0.22
176 0.17
177 0.14
178 0.14
179 0.13
180 0.16
181 0.15
182 0.12
183 0.12
184 0.14
185 0.21
186 0.22
187 0.23
188 0.23
189 0.29
190 0.29
191 0.29
192 0.29
193 0.22
194 0.23
195 0.22
196 0.24
197 0.2
198 0.23
199 0.25
200 0.25
201 0.32
202 0.31
203 0.38
204 0.35
205 0.36
206 0.35
207 0.34
208 0.35
209 0.31
210 0.35