Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K575

Protein Details
Accession Q1K575   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
178-210DRHPRRESFHVPKLCRRRRRRRWAGAGMPFVRRBasic
NLS Segment(s)
PositionSequence
193-202RRRRRRRWAG
Subcellular Location(s) mito 16.5, cyto_mito 9.5, nucl 7
Family & Domain DBs
KEGG ncr:NCU01834  -  
Amino Acid Sequences MSVSYVMAHSIGRNAMTARSLERKRVRRCVDLGGCLWPWRSRTNGGYWIRTSRSGSLPSAGSRSALWVPVSRRHPPSRLPQPDKVHRTLPRLALCPTIVQLSLRTRTTAGCYWLASRCRTISGMRVRSPPNFCSTPSVLHPSPAVGPFEVPQGERERERAVDNRTGRSTLSTISSSLDRHPRRESFHVPKLCRRRRRRRWAGAGMPFVRRTRQTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.16
5 0.18
6 0.26
7 0.29
8 0.37
9 0.46
10 0.54
11 0.62
12 0.71
13 0.73
14 0.71
15 0.72
16 0.72
17 0.68
18 0.63
19 0.56
20 0.5
21 0.44
22 0.38
23 0.37
24 0.29
25 0.26
26 0.24
27 0.26
28 0.27
29 0.29
30 0.33
31 0.41
32 0.42
33 0.45
34 0.44
35 0.46
36 0.43
37 0.42
38 0.39
39 0.33
40 0.33
41 0.31
42 0.3
43 0.27
44 0.26
45 0.25
46 0.24
47 0.2
48 0.17
49 0.14
50 0.16
51 0.14
52 0.14
53 0.14
54 0.16
55 0.19
56 0.25
57 0.3
58 0.33
59 0.39
60 0.42
61 0.44
62 0.45
63 0.53
64 0.56
65 0.62
66 0.63
67 0.65
68 0.69
69 0.75
70 0.75
71 0.68
72 0.64
73 0.59
74 0.57
75 0.53
76 0.5
77 0.44
78 0.41
79 0.39
80 0.33
81 0.29
82 0.24
83 0.2
84 0.15
85 0.12
86 0.09
87 0.11
88 0.12
89 0.15
90 0.15
91 0.15
92 0.15
93 0.15
94 0.18
95 0.17
96 0.17
97 0.15
98 0.15
99 0.16
100 0.2
101 0.22
102 0.2
103 0.2
104 0.18
105 0.18
106 0.19
107 0.18
108 0.21
109 0.28
110 0.32
111 0.34
112 0.38
113 0.39
114 0.43
115 0.46
116 0.4
117 0.37
118 0.32
119 0.31
120 0.32
121 0.31
122 0.28
123 0.27
124 0.32
125 0.26
126 0.26
127 0.25
128 0.2
129 0.21
130 0.19
131 0.18
132 0.11
133 0.12
134 0.11
135 0.14
136 0.14
137 0.12
138 0.13
139 0.17
140 0.2
141 0.2
142 0.22
143 0.22
144 0.23
145 0.26
146 0.29
147 0.29
148 0.35
149 0.37
150 0.4
151 0.4
152 0.39
153 0.36
154 0.33
155 0.29
156 0.22
157 0.22
158 0.18
159 0.16
160 0.17
161 0.19
162 0.17
163 0.22
164 0.3
165 0.3
166 0.34
167 0.41
168 0.44
169 0.49
170 0.55
171 0.6
172 0.59
173 0.66
174 0.7
175 0.68
176 0.74
177 0.78
178 0.81
179 0.81
180 0.83
181 0.85
182 0.87
183 0.93
184 0.94
185 0.94
186 0.95
187 0.95
188 0.94
189 0.91
190 0.89
191 0.81
192 0.75
193 0.69
194 0.6
195 0.55