Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NSC6

Protein Details
Accession A0A2T2NSC6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
126-159KKKSEGKEKAKGSKKKKGKKARARAKAKAKGKEEBasic
162-186PGGVRRTDKRPLAKKMKARLVRFCEHydrophilic
NLS Segment(s)
PositionSequence
126-180KKKSEGKEKAKGSKKKKGKKARARAKAKAKGKEEEGPGGVRRTDKRPLAKKMKAR
Subcellular Location(s) nucl 12.5, mito_nucl 10.5, mito 7.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MASSSTNKNTSSSPSEAEILNSINEVLIAEGKDPYNAPPVDVQELSKEMDWMINVFMHGLCVPDSPTHQVGRAPPRGMGIHYEWTDEVMDADRPPSAGPADASSSDGTNKNDKQQEAATATAAEDKKKSEGKEKAKGSKKKKGKKARARAKAKAKGKEEEGPGGVRRTDKRPLAKKMKARLVRFCEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.3
4 0.29
5 0.24
6 0.19
7 0.16
8 0.14
9 0.11
10 0.09
11 0.09
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.09
18 0.09
19 0.1
20 0.11
21 0.12
22 0.18
23 0.17
24 0.18
25 0.19
26 0.22
27 0.25
28 0.25
29 0.24
30 0.18
31 0.2
32 0.2
33 0.17
34 0.15
35 0.11
36 0.11
37 0.11
38 0.09
39 0.09
40 0.08
41 0.07
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.08
50 0.08
51 0.1
52 0.13
53 0.15
54 0.15
55 0.15
56 0.17
57 0.22
58 0.29
59 0.32
60 0.29
61 0.27
62 0.29
63 0.29
64 0.27
65 0.25
66 0.19
67 0.19
68 0.19
69 0.19
70 0.16
71 0.17
72 0.16
73 0.13
74 0.1
75 0.06
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.06
86 0.06
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.11
93 0.13
94 0.14
95 0.18
96 0.19
97 0.24
98 0.28
99 0.28
100 0.29
101 0.27
102 0.29
103 0.26
104 0.25
105 0.19
106 0.15
107 0.15
108 0.18
109 0.17
110 0.15
111 0.13
112 0.14
113 0.18
114 0.22
115 0.24
116 0.28
117 0.37
118 0.45
119 0.53
120 0.59
121 0.65
122 0.71
123 0.78
124 0.77
125 0.78
126 0.8
127 0.81
128 0.84
129 0.86
130 0.87
131 0.89
132 0.92
133 0.92
134 0.92
135 0.92
136 0.91
137 0.9
138 0.89
139 0.87
140 0.84
141 0.79
142 0.74
143 0.7
144 0.67
145 0.6
146 0.54
147 0.48
148 0.42
149 0.39
150 0.36
151 0.33
152 0.31
153 0.32
154 0.32
155 0.39
156 0.43
157 0.51
158 0.58
159 0.67
160 0.72
161 0.77
162 0.81
163 0.82
164 0.85
165 0.84
166 0.82
167 0.81
168 0.79