Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NEK1

Protein Details
Accession A0A2T2NEK1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-63LSPTCRREKIPKPEPTRDPRLRRKKKNGPPPPPQRPGCBasic
NLS Segment(s)
PositionSequence
32-58REKIPKPEPTRDPRLRRKKKNGPPPPP
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MMTAHHFPHSQAHRTLSQLAAPASDLSPTCRREKIPKPEPTRDPRLRRKKKNGPPPPPQRPGCQTRPDQTSQRTYRSGAGVLGRSITSSTSTSTSTSSTAIHDAENAMARRRSRPGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.34
4 0.3
5 0.27
6 0.24
7 0.19
8 0.18
9 0.16
10 0.13
11 0.14
12 0.12
13 0.14
14 0.2
15 0.23
16 0.26
17 0.28
18 0.31
19 0.39
20 0.49
21 0.54
22 0.58
23 0.65
24 0.7
25 0.75
26 0.8
27 0.78
28 0.79
29 0.77
30 0.77
31 0.78
32 0.81
33 0.83
34 0.86
35 0.89
36 0.89
37 0.9
38 0.91
39 0.91
40 0.89
41 0.89
42 0.89
43 0.87
44 0.84
45 0.77
46 0.7
47 0.65
48 0.62
49 0.58
50 0.54
51 0.49
52 0.46
53 0.49
54 0.49
55 0.49
56 0.46
57 0.5
58 0.47
59 0.47
60 0.43
61 0.4
62 0.39
63 0.35
64 0.31
65 0.23
66 0.22
67 0.19
68 0.17
69 0.16
70 0.13
71 0.12
72 0.11
73 0.1
74 0.09
75 0.09
76 0.11
77 0.12
78 0.13
79 0.14
80 0.15
81 0.15
82 0.14
83 0.15
84 0.14
85 0.14
86 0.15
87 0.15
88 0.14
89 0.13
90 0.13
91 0.14
92 0.19
93 0.18
94 0.21
95 0.25
96 0.27
97 0.31
98 0.39