Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NJX7

Protein Details
Accession A0A2T2NJX7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-89ELLRNSKDKRARRLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
71-93SKDKRARRLAKKRLGTFGRAKRK
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MPKEVKQKSGLIVGINAGHKVTPRTPAARISRRKGFLSKRTAFVREITREVAGYVELSEYEKRVIELLRNSKDKRARRLAKKRLGTFGRAKRKVDEMTKVIAESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.2
4 0.15
5 0.13
6 0.14
7 0.17
8 0.17
9 0.19
10 0.23
11 0.26
12 0.28
13 0.35
14 0.44
15 0.49
16 0.56
17 0.57
18 0.61
19 0.62
20 0.63
21 0.63
22 0.62
23 0.61
24 0.63
25 0.59
26 0.57
27 0.56
28 0.55
29 0.48
30 0.43
31 0.41
32 0.34
33 0.33
34 0.28
35 0.25
36 0.22
37 0.21
38 0.17
39 0.11
40 0.08
41 0.06
42 0.04
43 0.04
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.11
53 0.17
54 0.25
55 0.3
56 0.37
57 0.38
58 0.44
59 0.52
60 0.55
61 0.57
62 0.61
63 0.65
64 0.7
65 0.8
66 0.83
67 0.85
68 0.87
69 0.82
70 0.81
71 0.75
72 0.7
73 0.69
74 0.69
75 0.7
76 0.67
77 0.65
78 0.58
79 0.61
80 0.62
81 0.59
82 0.57
83 0.49
84 0.48
85 0.47
86 0.44
87 0.42
88 0.38
89 0.34