Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S4W2

Protein Details
Accession Q7S4W2    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGIFAKRTKCKTRRRLRDVDQVQKDLHydrophilic
63-88STLVKHTKGKPHKRRLKELKEGPYTHBasic
NLS Segment(s)
PositionSequence
69-80TKGKPHKRRLKE
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG ncr:NCU02364  -  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGIFAKRTKCKTRRRLRDVDQVQKDLINARHLELYKETKAVEDLPGLGRHYCVECAKWFDMESTLVKHTKGKPHKRRLKELKEGPYTHKEADAAVGLWTDNGRPRNTTTEIDMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.88
4 0.89
5 0.88
6 0.88
7 0.83
8 0.74
9 0.65
10 0.55
11 0.47
12 0.42
13 0.34
14 0.28
15 0.22
16 0.21
17 0.25
18 0.25
19 0.26
20 0.25
21 0.28
22 0.24
23 0.25
24 0.24
25 0.19
26 0.2
27 0.19
28 0.16
29 0.11
30 0.11
31 0.11
32 0.13
33 0.13
34 0.12
35 0.11
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.11
42 0.16
43 0.16
44 0.16
45 0.15
46 0.13
47 0.14
48 0.14
49 0.13
50 0.11
51 0.13
52 0.13
53 0.14
54 0.18
55 0.21
56 0.29
57 0.39
58 0.48
59 0.57
60 0.67
61 0.77
62 0.79
63 0.87
64 0.88
65 0.87
66 0.87
67 0.85
68 0.83
69 0.82
70 0.77
71 0.72
72 0.68
73 0.62
74 0.52
75 0.44
76 0.35
77 0.27
78 0.26
79 0.21
80 0.14
81 0.11
82 0.11
83 0.09
84 0.09
85 0.09
86 0.09
87 0.14
88 0.18
89 0.19
90 0.22
91 0.26
92 0.32
93 0.36
94 0.37