Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NDA4

Protein Details
Accession A0A2T2NDA4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-25HVLPRYTYSRRRCPPPHQHRFALPHydrophilic
118-145SMPPPLLLWRRGRRRRRWRRRFLFPAQSHydrophilic
NLS Segment(s)
PositionSequence
127-138RRGRRRRRWRRR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHVLPRYTYSRRRCPPPHQHRFALPCPPFPDLSLTATSPSPIPIPHPTYAPNRPPSTDAALAPRRDGREDRTGWERIGRVRTGASSARDRRNGLATRLHCAPPTTLPTLERHFQSNSSMPPPLLLWRRGRRRRRWRRRFLFPAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.86
4 0.87
5 0.84
6 0.81
7 0.79
8 0.78
9 0.72
10 0.71
11 0.62
12 0.56
13 0.52
14 0.5
15 0.42
16 0.36
17 0.36
18 0.27
19 0.28
20 0.24
21 0.21
22 0.21
23 0.2
24 0.19
25 0.14
26 0.13
27 0.11
28 0.09
29 0.13
30 0.17
31 0.21
32 0.22
33 0.23
34 0.26
35 0.32
36 0.39
37 0.42
38 0.42
39 0.39
40 0.4
41 0.4
42 0.4
43 0.38
44 0.33
45 0.26
46 0.27
47 0.3
48 0.29
49 0.29
50 0.28
51 0.24
52 0.25
53 0.26
54 0.23
55 0.26
56 0.27
57 0.29
58 0.3
59 0.31
60 0.28
61 0.29
62 0.26
63 0.22
64 0.24
65 0.21
66 0.17
67 0.16
68 0.16
69 0.17
70 0.19
71 0.18
72 0.23
73 0.3
74 0.34
75 0.37
76 0.38
77 0.37
78 0.42
79 0.41
80 0.36
81 0.37
82 0.33
83 0.34
84 0.36
85 0.35
86 0.28
87 0.27
88 0.25
89 0.21
90 0.25
91 0.24
92 0.22
93 0.23
94 0.26
95 0.29
96 0.31
97 0.28
98 0.27
99 0.25
100 0.25
101 0.29
102 0.29
103 0.29
104 0.29
105 0.29
106 0.25
107 0.25
108 0.25
109 0.28
110 0.29
111 0.31
112 0.37
113 0.46
114 0.57
115 0.67
116 0.76
117 0.8
118 0.85
119 0.91
120 0.93
121 0.94
122 0.95
123 0.94
124 0.95
125 0.94