FuNGI

A0A2T2ND70

Protein Details

Accession

A0A2T2ND70

Localization Confidence

Medium

Confidence Score

14.6

NoLS Segment(s)

Position	Sequence	Protein Nature
53-96	AADSPDAPKQKRKYTKKPKVDGNGDPLPLKPKKRVREENGEEAA	Hydrophilic
309-335	GLTPPMRYVRKRRFRPRKSYQHIEQIE	Hydrophilic

NLS Segment(s)

Position	Sequence
60-105	PKQKRKYTKKPKVDGNGDPLPLKPKKRVREENGEEAAPSAKRKPKP
318-325	RKRRFRPR

Subcellular Location(s)

cyto 10.5, cyto_nucl 10.5, nucl 9.5, mito 6

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MKIKIKNPNAEGAATPKPASASASASAPAATPSDTGSGGVKLKFKLGASGGAAADSPDAPKQKRKYTKKPKVDGNGDPLPLKPKKRVREENGEEAAPSAKRKPKPTAKSMDLVHDSDDDDPAMVPRPKLRVDPSRTQSVKLSFKKTPTAQSRGGIGLIKVKGVGKPPPRPPGVGYDSEAEEAEVDPAIESQFVLRMPPGPDCDLLRKSIEEKTIGKSQANGGPGVYFRFFDREGRRAMITIQGRMYAASMVELPCVIESMKSWNKKDWVKTADICQMLLVLGRVQNEDEAKKYPRPRDVDPDSHRYAHGLTPPMRYVRKRRFRPRKSYQHIEQIEQLTQQLEQDDQMAERTEYTMVDSNDETSSGDSDDDAEGEDEDMMDAQHFVETPAAEAVDEQDMLNMFMNDDGADGGLDALFGDGATVDVETPATAHDVAMHALGSKDTAILEVDTAASTPAAATSPDDDDDDDADSDDDGEVDEAAAARQQANEQMRAEVREIEQAIEQSRVQLEQTKNVLMKKRIEAKIEKQMADKAIKLAMLGEGDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.34
3	0.27
4	0.25
5	0.24
6	0.25
7	0.21
8	0.19
9	0.19
10	0.2
11	0.19
12	0.19
13	0.18
14	0.15
15	0.14
16	0.11
17	0.11
18	0.09
19	0.1
20	0.12
21	0.12
22	0.13
23	0.13
24	0.16
25	0.18
26	0.21
27	0.24
28	0.22
29	0.25
30	0.27
31	0.26
32	0.27
33	0.26
34	0.27
35	0.25
36	0.28
37	0.25
38	0.22
39	0.22
40	0.17
41	0.16
42	0.12
43	0.11
44	0.12
45	0.19
46	0.22
47	0.31
48	0.39
49	0.48
50	0.59
51	0.68
52	0.75
53	0.81
54	0.88
55	0.9
56	0.92
57	0.91
58	0.91
59	0.88
60	0.83
61	0.8
62	0.75
63	0.66
64	0.58
65	0.49
66	0.47
67	0.45
68	0.42
69	0.44
70	0.47
71	0.54
72	0.64
73	0.74
74	0.74
75	0.79
76	0.82
77	0.82
78	0.76
79	0.67
80	0.56
81	0.46
82	0.41
83	0.31
84	0.26
85	0.24
86	0.28
87	0.34
88	0.41
89	0.5
90	0.58
91	0.65
92	0.73
93	0.75
94	0.71
95	0.72
96	0.67
97	0.65
98	0.58
99	0.5
100	0.42
101	0.33
102	0.29
103	0.23
104	0.22
105	0.14
106	0.1
107	0.1
108	0.09
109	0.14
110	0.15
111	0.16
112	0.19
113	0.23
114	0.25
115	0.3
116	0.36
117	0.4
118	0.46
119	0.55
120	0.56
121	0.62
122	0.61
123	0.58
124	0.56
125	0.54
126	0.56
127	0.52
128	0.54
129	0.48
130	0.5
131	0.56
132	0.54
133	0.56
134	0.54
135	0.55
136	0.52
137	0.49
138	0.48
139	0.41
140	0.39
141	0.3
142	0.23
143	0.22
144	0.19
145	0.17
146	0.16
147	0.16
148	0.16
149	0.19
150	0.26
151	0.28
152	0.36
153	0.44
154	0.5
155	0.51
156	0.51
157	0.49
158	0.5
159	0.47
160	0.41
161	0.35
162	0.3
163	0.29
164	0.28
165	0.26
166	0.17
167	0.12
168	0.1
169	0.08
170	0.06
171	0.05
172	0.04
173	0.05
174	0.05
175	0.04
176	0.04
177	0.04
178	0.05
179	0.05
180	0.06
181	0.06
182	0.1
183	0.11
184	0.13
185	0.16
186	0.16
187	0.17
188	0.19
189	0.24
190	0.22
191	0.23
192	0.22
193	0.2
194	0.21
195	0.23
196	0.24
197	0.22
198	0.22
199	0.25
200	0.3
201	0.3
202	0.28
203	0.25
204	0.26
205	0.26
206	0.25
207	0.21
208	0.15
209	0.14
210	0.14
211	0.15
212	0.12
213	0.09
214	0.08
215	0.11
216	0.12
217	0.18
218	0.22
219	0.24
220	0.25
221	0.27
222	0.27
223	0.24
224	0.24
225	0.24
226	0.21
227	0.2
228	0.18
229	0.16
230	0.16
231	0.16
232	0.15
233	0.09
234	0.07
235	0.05
236	0.06
237	0.05
238	0.05
239	0.05
240	0.05
241	0.05
242	0.05
243	0.05
244	0.04
245	0.04
246	0.12
247	0.18
248	0.22
249	0.24
250	0.27
251	0.33
252	0.37
253	0.41
254	0.41
255	0.39
256	0.39
257	0.39
258	0.4
259	0.4
260	0.35
261	0.31
262	0.23
263	0.19
264	0.15
265	0.14
266	0.1
267	0.05
268	0.06
269	0.06
270	0.07
271	0.07
272	0.08
273	0.09
274	0.1
275	0.11
276	0.13
277	0.16
278	0.21
279	0.27
280	0.31
281	0.37
282	0.41
283	0.43
284	0.49
285	0.52
286	0.57
287	0.56
288	0.57
289	0.53
290	0.49
291	0.46
292	0.37
293	0.32
294	0.24
295	0.23
296	0.22
297	0.21
298	0.23
299	0.24
300	0.28
301	0.31
302	0.33
303	0.39
304	0.44
305	0.53
306	0.61
307	0.7
308	0.78
309	0.84
310	0.9
311	0.9
312	0.91
313	0.89
314	0.88
315	0.82
316	0.81
317	0.73
318	0.65
319	0.58
320	0.49
321	0.41
322	0.32
323	0.27
324	0.17
325	0.15
326	0.13
327	0.09
328	0.07
329	0.07
330	0.07
331	0.07
332	0.07
333	0.08
334	0.08
335	0.08
336	0.08
337	0.09
338	0.08
339	0.07
340	0.1
341	0.13
342	0.12
343	0.14
344	0.14
345	0.15
346	0.15
347	0.15
348	0.13
349	0.09
350	0.09
351	0.08
352	0.08
353	0.06
354	0.07
355	0.07
356	0.07
357	0.07
358	0.06
359	0.06
360	0.06
361	0.06
362	0.05
363	0.04
364	0.05
365	0.04
366	0.04
367	0.04
368	0.04
369	0.04
370	0.04
371	0.05
372	0.06
373	0.06
374	0.07
375	0.07
376	0.07
377	0.07
378	0.07
379	0.08
380	0.07
381	0.07
382	0.06
383	0.07
384	0.07
385	0.08
386	0.09
387	0.07
388	0.07
389	0.06
390	0.07
391	0.06
392	0.06
393	0.05
394	0.04
395	0.04
396	0.04
397	0.04
398	0.03
399	0.03
400	0.03
401	0.03
402	0.03
403	0.03
404	0.03
405	0.02
406	0.03
407	0.03
408	0.03
409	0.03
410	0.04
411	0.04
412	0.04
413	0.04
414	0.04
415	0.06
416	0.06
417	0.06
418	0.07
419	0.08
420	0.09
421	0.09
422	0.08
423	0.07
424	0.07
425	0.08
426	0.07
427	0.06
428	0.06
429	0.06
430	0.06
431	0.07
432	0.07
433	0.07
434	0.07
435	0.07
436	0.06
437	0.07
438	0.06
439	0.05
440	0.05
441	0.05
442	0.05
443	0.05
444	0.05
445	0.07
446	0.09
447	0.11
448	0.12
449	0.13
450	0.13
451	0.13
452	0.14
453	0.15
454	0.13
455	0.11
456	0.1
457	0.1
458	0.09
459	0.08
460	0.07
461	0.06
462	0.06
463	0.05
464	0.05
465	0.05
466	0.05
467	0.05
468	0.06
469	0.07
470	0.07
471	0.08
472	0.09
473	0.17
474	0.21
475	0.25
476	0.25
477	0.29
478	0.3
479	0.32
480	0.33
481	0.29
482	0.26
483	0.28
484	0.27
485	0.24
486	0.24
487	0.24
488	0.24
489	0.23
490	0.22
491	0.18
492	0.18
493	0.18
494	0.17
495	0.23
496	0.24
497	0.3
498	0.33
499	0.36
500	0.39
501	0.44
502	0.51
503	0.49
504	0.53
505	0.54
506	0.61
507	0.61
508	0.65
509	0.67
510	0.67
511	0.72
512	0.72
513	0.66
514	0.58
515	0.58
516	0.57
517	0.52
518	0.46
519	0.37
520	0.32
521	0.3
522	0.27
523	0.22
524	0.18

A0A2T2ND70

3D AlphaFold-predicted Structure Viewer