Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NLI7

Protein Details
Accession A0A2T2NLI7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-56KYTVLKPTPSKIKKRQKYADKQASKPAHydrophilic
NLS Segment(s)
PositionSequence
42-44KKR
150-164PKAGGGGKKKKKGKK
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYFKTSTEWYEQSSLLLKARPTSTRITSKYTVLKPTPSKIKKRQKYADKQASKPASDRPSSPAPQAQNPEEPTATFTLKTYDPESGTCLQYVTTKGAEVGRLVGSLGRLSRHMAAMPEIAEDLGASAEGPSTPQVEADVQMGGTAPAEPKAGGGGKKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.23
4 0.24
5 0.21
6 0.23
7 0.27
8 0.28
9 0.28
10 0.32
11 0.36
12 0.43
13 0.45
14 0.47
15 0.46
16 0.49
17 0.54
18 0.52
19 0.53
20 0.46
21 0.51
22 0.48
23 0.53
24 0.58
25 0.58
26 0.64
27 0.67
28 0.76
29 0.76
30 0.82
31 0.85
32 0.85
33 0.88
34 0.89
35 0.9
36 0.86
37 0.8
38 0.79
39 0.74
40 0.64
41 0.55
42 0.51
43 0.46
44 0.4
45 0.38
46 0.34
47 0.36
48 0.36
49 0.37
50 0.34
51 0.31
52 0.34
53 0.36
54 0.33
55 0.32
56 0.32
57 0.31
58 0.26
59 0.24
60 0.21
61 0.19
62 0.17
63 0.12
64 0.11
65 0.11
66 0.12
67 0.13
68 0.13
69 0.12
70 0.12
71 0.13
72 0.16
73 0.16
74 0.16
75 0.14
76 0.13
77 0.11
78 0.12
79 0.13
80 0.12
81 0.1
82 0.09
83 0.1
84 0.11
85 0.11
86 0.1
87 0.1
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.08
95 0.07
96 0.08
97 0.1
98 0.11
99 0.11
100 0.12
101 0.12
102 0.12
103 0.13
104 0.12
105 0.11
106 0.1
107 0.09
108 0.07
109 0.06
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.05
118 0.05
119 0.07
120 0.07
121 0.07
122 0.09
123 0.09
124 0.11
125 0.11
126 0.1
127 0.09
128 0.09
129 0.09
130 0.07
131 0.07
132 0.06
133 0.06
134 0.07
135 0.08
136 0.08
137 0.08
138 0.12
139 0.15
140 0.2
141 0.29
142 0.39
143 0.48
144 0.58