Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2N889

Protein Details
Accession A0A2T2N889    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
156-189PLASLCEAPRPRRRRRRRPRPRPQLQHRKLNSVPBasic
NLS Segment(s)
PositionSequence
164-179PRPRRRRRRRPRPRPQ
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 7, extr 4
Family & Domain DBs
Amino Acid Sequences MAPVRDSQTGPTGQAGQPGAGLAQRNPPKRAQTFHVCFAPCWTFARSSLDGHRMGAGRPFGRLVGRVGSAGRVCAQETTGTACTVCVRVCTSCVARLDSSTRPPEETYRRHPPTQYSGAASCPPPPRQPRAQSQRQPAPSTGCASAHARRTAHCLPLASLCEAPRPRRRRRRRPRPRPQLQHRKLNSVPCRCPTTALPDAVLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.21
4 0.19
5 0.18
6 0.16
7 0.14
8 0.15
9 0.11
10 0.2
11 0.28
12 0.33
13 0.36
14 0.41
15 0.48
16 0.51
17 0.55
18 0.53
19 0.56
20 0.56
21 0.58
22 0.59
23 0.51
24 0.46
25 0.47
26 0.42
27 0.32
28 0.3
29 0.26
30 0.22
31 0.22
32 0.29
33 0.26
34 0.26
35 0.3
36 0.32
37 0.3
38 0.29
39 0.3
40 0.24
41 0.23
42 0.23
43 0.23
44 0.18
45 0.18
46 0.18
47 0.16
48 0.16
49 0.17
50 0.15
51 0.13
52 0.13
53 0.13
54 0.13
55 0.14
56 0.13
57 0.13
58 0.12
59 0.11
60 0.11
61 0.1
62 0.11
63 0.08
64 0.09
65 0.13
66 0.12
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.11
73 0.08
74 0.08
75 0.09
76 0.1
77 0.12
78 0.13
79 0.15
80 0.17
81 0.18
82 0.16
83 0.17
84 0.2
85 0.19
86 0.23
87 0.22
88 0.21
89 0.2
90 0.21
91 0.26
92 0.3
93 0.33
94 0.36
95 0.43
96 0.47
97 0.48
98 0.48
99 0.46
100 0.46
101 0.46
102 0.4
103 0.32
104 0.29
105 0.28
106 0.29
107 0.25
108 0.24
109 0.23
110 0.24
111 0.29
112 0.33
113 0.37
114 0.44
115 0.5
116 0.54
117 0.59
118 0.67
119 0.68
120 0.72
121 0.75
122 0.71
123 0.68
124 0.6
125 0.56
126 0.47
127 0.43
128 0.35
129 0.27
130 0.24
131 0.25
132 0.28
133 0.28
134 0.31
135 0.28
136 0.28
137 0.35
138 0.36
139 0.35
140 0.33
141 0.29
142 0.26
143 0.3
144 0.31
145 0.25
146 0.24
147 0.2
148 0.26
149 0.29
150 0.36
151 0.41
152 0.48
153 0.57
154 0.66
155 0.77
156 0.81
157 0.88
158 0.92
159 0.94
160 0.97
161 0.97
162 0.97
163 0.97
164 0.97
165 0.97
166 0.97
167 0.94
168 0.93
169 0.86
170 0.84
171 0.78
172 0.77
173 0.75
174 0.73
175 0.72
176 0.66
177 0.69
178 0.6
179 0.6
180 0.52
181 0.51
182 0.48
183 0.43
184 0.39