Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NVD4

Protein Details
Accession A0A2T2NVD4   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29PSNKQTQNTSRGKPKPRRMERTGNPPSLHydrophilic
NLS Segment(s)
PositionSequence
12-24RGKPKPRRMERTG
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MPSNKQTQNTSRGKPKPRRMERTGNPPSLYHPRGRRRLTHPTTSYLCYPHLRSPLVCSREELIGRGERDTTSIVTVTVPFARYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.83
4 0.86
5 0.87
6 0.85
7 0.87
8 0.84
9 0.84
10 0.82
11 0.76
12 0.66
13 0.57
14 0.55
15 0.53
16 0.48
17 0.43
18 0.44
19 0.48
20 0.56
21 0.59
22 0.6
23 0.58
24 0.67
25 0.66
26 0.66
27 0.59
28 0.55
29 0.54
30 0.49
31 0.43
32 0.33
33 0.31
34 0.24
35 0.25
36 0.24
37 0.25
38 0.25
39 0.24
40 0.28
41 0.34
42 0.35
43 0.32
44 0.3
45 0.28
46 0.31
47 0.31
48 0.26
49 0.22
50 0.24
51 0.24
52 0.23
53 0.23
54 0.18
55 0.19
56 0.2
57 0.17
58 0.14
59 0.13
60 0.12
61 0.12
62 0.13
63 0.14
64 0.14