Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7UWH3

Protein Details
Accession A7UWH3   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-40GCRADGKNKRSRRTRGGKQAGSBasic
NLS Segment(s)
PositionSequence
25-36KNKRSRRTRGGK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, cyto 8, cyto_pero 4.833
Family & Domain DBs
KEGG ncr:NCU10396  -  
Amino Acid Sequences MINYGSIYDGLKTTPPCAGCRADGKNKRSRRTRGGKQAGSPVGHSSPVRLMIDDDVDDDDDDDDDANADDEVFISKRRVDEVRTGAMVPMNPDPPTPLVPIRNPPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.21
4 0.24
5 0.26
6 0.25
7 0.31
8 0.37
9 0.44
10 0.51
11 0.56
12 0.61
13 0.67
14 0.72
15 0.75
16 0.75
17 0.75
18 0.77
19 0.8
20 0.82
21 0.84
22 0.78
23 0.72
24 0.72
25 0.65
26 0.55
27 0.46
28 0.37
29 0.28
30 0.26
31 0.23
32 0.16
33 0.13
34 0.15
35 0.15
36 0.12
37 0.12
38 0.1
39 0.11
40 0.1
41 0.09
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.05
59 0.06
60 0.07
61 0.08
62 0.1
63 0.1
64 0.14
65 0.16
66 0.18
67 0.26
68 0.29
69 0.32
70 0.32
71 0.31
72 0.29
73 0.28
74 0.26
75 0.21
76 0.19
77 0.18
78 0.17
79 0.17
80 0.19
81 0.2
82 0.22
83 0.23
84 0.25
85 0.29
86 0.33