Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P255

Protein Details
Accession A0A2T2P255    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TSSPRAPRGKHHHSKSATQTHydrophilic
29-52ANNGNASQRRRRGNRAPNGHAHPHHydrophilic
446-476NQPYREPPNNRKPRTPGRRPFHPRPDSHPHABasic
NLS Segment(s)
PositionSequence
38-40RRR
455-466NRKPRTPGRRPF
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSSTQNTSSPRAPRGKHHHSKSATQTPPANNGNASQRRRRGNRAPNGHAHPHGDAQAAAAHKAAPLHDPAFSDSAVFSSEDVHLPKGPRNAKKHTNSQPASDRVFSPSAVATASLTDSELAPINHSTPVKVQGAYAGASFNASPAANKLPIPKFLSKSVPAKPRTGIPTPPPEDGSDSASSPTPSPPSPSRAPIPVPPRHEDSPLDMLFKADRAEKARNGNGSPASAAFNSPQPPSTNGRPNHVKHDSYSSLNTVFPIELDGEARNPRNSPPSASPQAFRSVTEPSKVPQVSNGAYPAASDPMQDLLNRLSISKNTVNSTPQPAEHAPSDPSSRHHTPSPFYDGRSPFRSASGPTTPVPAAQSSDFFYGNSKNLSPLFKQIQADSPRHNSGLRTEITADSPLMQQGGFAPVSPPQFQQDPNAVSRHYLDNVLNGPVSPRRGSVPHNQPYREPPNNRKPRTPGRRPFHPRPDSHPHATISGSPNGNVHSPPISMPKASTTMSFIPSSVQAKQHSVSTTPKQSDNSALEQDLKRLLNMSVAGDTTGVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.76
4 0.77
5 0.78
6 0.75
7 0.8
8 0.8
9 0.8
10 0.73
11 0.69
12 0.68
13 0.63
14 0.66
15 0.61
16 0.53
17 0.43
18 0.43
19 0.47
20 0.49
21 0.51
22 0.52
23 0.57
24 0.65
25 0.71
26 0.77
27 0.77
28 0.79
29 0.82
30 0.83
31 0.83
32 0.82
33 0.82
34 0.79
35 0.71
36 0.64
37 0.56
38 0.48
39 0.42
40 0.34
41 0.27
42 0.21
43 0.21
44 0.19
45 0.16
46 0.14
47 0.12
48 0.12
49 0.13
50 0.13
51 0.12
52 0.15
53 0.16
54 0.17
55 0.19
56 0.21
57 0.22
58 0.2
59 0.19
60 0.14
61 0.14
62 0.13
63 0.12
64 0.09
65 0.09
66 0.11
67 0.13
68 0.15
69 0.16
70 0.19
71 0.21
72 0.25
73 0.32
74 0.4
75 0.45
76 0.52
77 0.59
78 0.65
79 0.71
80 0.76
81 0.78
82 0.8
83 0.74
84 0.73
85 0.72
86 0.68
87 0.64
88 0.56
89 0.46
90 0.4
91 0.39
92 0.32
93 0.25
94 0.2
95 0.17
96 0.15
97 0.14
98 0.09
99 0.09
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.08
106 0.1
107 0.09
108 0.11
109 0.11
110 0.12
111 0.16
112 0.16
113 0.16
114 0.16
115 0.22
116 0.22
117 0.21
118 0.2
119 0.18
120 0.2
121 0.19
122 0.17
123 0.12
124 0.09
125 0.1
126 0.1
127 0.07
128 0.07
129 0.07
130 0.07
131 0.09
132 0.12
133 0.13
134 0.14
135 0.22
136 0.23
137 0.29
138 0.34
139 0.37
140 0.37
141 0.4
142 0.44
143 0.42
144 0.45
145 0.48
146 0.51
147 0.48
148 0.49
149 0.46
150 0.46
151 0.47
152 0.44
153 0.42
154 0.39
155 0.46
156 0.46
157 0.46
158 0.42
159 0.37
160 0.37
161 0.33
162 0.31
163 0.22
164 0.19
165 0.19
166 0.18
167 0.18
168 0.15
169 0.16
170 0.14
171 0.13
172 0.18
173 0.2
174 0.26
175 0.28
176 0.31
177 0.32
178 0.33
179 0.35
180 0.36
181 0.41
182 0.42
183 0.43
184 0.43
185 0.46
186 0.44
187 0.44
188 0.39
189 0.35
190 0.36
191 0.32
192 0.3
193 0.24
194 0.23
195 0.2
196 0.2
197 0.16
198 0.11
199 0.13
200 0.16
201 0.21
202 0.24
203 0.3
204 0.32
205 0.34
206 0.32
207 0.33
208 0.29
209 0.26
210 0.22
211 0.17
212 0.15
213 0.13
214 0.13
215 0.1
216 0.12
217 0.14
218 0.13
219 0.14
220 0.14
221 0.18
222 0.22
223 0.27
224 0.33
225 0.32
226 0.38
227 0.44
228 0.44
229 0.5
230 0.5
231 0.44
232 0.37
233 0.42
234 0.39
235 0.33
236 0.32
237 0.25
238 0.22
239 0.21
240 0.2
241 0.13
242 0.11
243 0.08
244 0.08
245 0.07
246 0.06
247 0.07
248 0.06
249 0.08
250 0.1
251 0.12
252 0.12
253 0.12
254 0.13
255 0.18
256 0.18
257 0.2
258 0.22
259 0.27
260 0.32
261 0.32
262 0.32
263 0.28
264 0.33
265 0.3
266 0.26
267 0.21
268 0.21
269 0.21
270 0.21
271 0.2
272 0.15
273 0.22
274 0.22
275 0.2
276 0.17
277 0.2
278 0.19
279 0.2
280 0.2
281 0.13
282 0.13
283 0.13
284 0.11
285 0.09
286 0.08
287 0.07
288 0.07
289 0.08
290 0.09
291 0.08
292 0.09
293 0.08
294 0.1
295 0.1
296 0.11
297 0.1
298 0.1
299 0.15
300 0.17
301 0.19
302 0.18
303 0.2
304 0.22
305 0.23
306 0.28
307 0.24
308 0.22
309 0.24
310 0.23
311 0.23
312 0.22
313 0.21
314 0.17
315 0.18
316 0.2
317 0.17
318 0.19
319 0.24
320 0.26
321 0.27
322 0.3
323 0.31
324 0.31
325 0.35
326 0.41
327 0.35
328 0.34
329 0.39
330 0.38
331 0.4
332 0.41
333 0.4
334 0.32
335 0.32
336 0.32
337 0.26
338 0.28
339 0.27
340 0.26
341 0.23
342 0.26
343 0.23
344 0.23
345 0.22
346 0.17
347 0.15
348 0.13
349 0.14
350 0.13
351 0.15
352 0.14
353 0.13
354 0.14
355 0.15
356 0.16
357 0.16
358 0.15
359 0.15
360 0.17
361 0.21
362 0.2
363 0.25
364 0.27
365 0.29
366 0.3
367 0.29
368 0.35
369 0.37
370 0.39
371 0.37
372 0.39
373 0.37
374 0.37
375 0.37
376 0.3
377 0.28
378 0.3
379 0.26
380 0.22
381 0.22
382 0.22
383 0.22
384 0.22
385 0.19
386 0.14
387 0.14
388 0.12
389 0.11
390 0.09
391 0.08
392 0.08
393 0.11
394 0.09
395 0.09
396 0.09
397 0.12
398 0.16
399 0.17
400 0.17
401 0.17
402 0.2
403 0.21
404 0.25
405 0.28
406 0.29
407 0.3
408 0.31
409 0.28
410 0.27
411 0.28
412 0.27
413 0.21
414 0.21
415 0.19
416 0.2
417 0.22
418 0.22
419 0.2
420 0.16
421 0.18
422 0.18
423 0.21
424 0.18
425 0.17
426 0.19
427 0.23
428 0.28
429 0.35
430 0.43
431 0.48
432 0.55
433 0.55
434 0.55
435 0.61
436 0.66
437 0.65
438 0.63
439 0.65
440 0.69
441 0.78
442 0.8
443 0.79
444 0.78
445 0.8
446 0.82
447 0.83
448 0.83
449 0.8
450 0.86
451 0.88
452 0.89
453 0.89
454 0.87
455 0.81
456 0.78
457 0.8
458 0.77
459 0.74
460 0.68
461 0.58
462 0.51
463 0.48
464 0.45
465 0.39
466 0.38
467 0.33
468 0.28
469 0.28
470 0.28
471 0.28
472 0.23
473 0.21
474 0.16
475 0.16
476 0.18
477 0.24
478 0.24
479 0.23
480 0.24
481 0.25
482 0.27
483 0.27
484 0.26
485 0.24
486 0.26
487 0.28
488 0.28
489 0.24
490 0.22
491 0.26
492 0.28
493 0.26
494 0.28
495 0.28
496 0.31
497 0.33
498 0.35
499 0.33
500 0.34
501 0.38
502 0.41
503 0.47
504 0.47
505 0.5
506 0.49
507 0.49
508 0.53
509 0.5
510 0.47
511 0.41
512 0.39
513 0.42
514 0.4
515 0.4
516 0.38
517 0.34
518 0.29
519 0.27
520 0.25
521 0.22
522 0.22
523 0.22
524 0.18
525 0.17
526 0.17