Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P393

Protein Details
Accession A0A2T2P393   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-105NSKICGRYAKCKDCRQRQKMLEQVQKKERKKKGHLTPNASQCKHydrophilic
NLS Segment(s)
PositionSequence
88-94KKERKKK
Subcellular Location(s) mito 14, nucl 10, plas 2
Family & Domain DBs
Amino Acid Sequences MLLLLSVCGFHPALCPPNSVTHSRARPTQLSLGQCKCSNPNAAPMQCRYMLMDERTNENVISNSKICGRYAKCKDCRQRQKMLEQVQKKERKKKGHLTPNASQCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.29
5 0.32
6 0.33
7 0.33
8 0.35
9 0.4
10 0.42
11 0.44
12 0.42
13 0.41
14 0.42
15 0.45
16 0.42
17 0.41
18 0.45
19 0.43
20 0.42
21 0.41
22 0.38
23 0.34
24 0.32
25 0.31
26 0.25
27 0.29
28 0.32
29 0.33
30 0.34
31 0.33
32 0.33
33 0.29
34 0.28
35 0.21
36 0.18
37 0.18
38 0.18
39 0.2
40 0.18
41 0.2
42 0.21
43 0.21
44 0.18
45 0.16
46 0.15
47 0.12
48 0.14
49 0.12
50 0.12
51 0.15
52 0.16
53 0.16
54 0.22
55 0.25
56 0.32
57 0.41
58 0.5
59 0.55
60 0.63
61 0.73
62 0.77
63 0.85
64 0.81
65 0.82
66 0.78
67 0.8
68 0.8
69 0.8
70 0.78
71 0.74
72 0.76
73 0.76
74 0.8
75 0.79
76 0.8
77 0.79
78 0.8
79 0.82
80 0.84
81 0.85
82 0.86
83 0.88
84 0.86
85 0.86