Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K771

Protein Details
Accession Q1K771   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
204-229TSEKLHLSKPKERKRWGYDKAVHGKTBasic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 8.5, cyto_mito 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008914  PEBP  
IPR036610  PEBP-like_sf  
IPR035810  PEBP_euk  
Gene Ontology GO:0030414  F:peptidase inhibitor activity  
GO:0005543  F:phospholipid binding  
GO:0030162  P:regulation of proteolysis  
GO:0046578  P:regulation of Ras protein signal transduction  
KEGG ncr:NCU01112  -  
Pfam View protein in Pfam  
PF01161  PBP  
CDD cd00866  PEBP_euk  
Amino Acid Sequences MKLAFGLVIFGQLARLAYAASLVRLPNQHVLAGELDNGDQQAAKLPHEVRKALKKAEIIPTVMDDFVPTLDLKVKWSHGIKASLGNTLKPKDLQDPPSIRLKDLVASTACLRHSSTSLVIVITDPDAPSRDDPKWSEFCHWIAVGPLVTADCPISDEQTQIHGCCSSDSLGTLEDIVSYTPPAPPEKTGKHRYVILALAPVNGTSEKLHLSKPKERKRWGYDKAVHGKTHGVREWAVENGLVPFAANFIYAQNKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.08
6 0.08
7 0.09
8 0.11
9 0.11
10 0.15
11 0.16
12 0.2
13 0.23
14 0.24
15 0.24
16 0.21
17 0.23
18 0.21
19 0.2
20 0.18
21 0.12
22 0.11
23 0.11
24 0.11
25 0.09
26 0.07
27 0.06
28 0.13
29 0.14
30 0.15
31 0.2
32 0.23
33 0.29
34 0.34
35 0.37
36 0.36
37 0.45
38 0.49
39 0.47
40 0.49
41 0.46
42 0.47
43 0.52
44 0.49
45 0.4
46 0.35
47 0.34
48 0.3
49 0.26
50 0.21
51 0.12
52 0.1
53 0.08
54 0.09
55 0.06
56 0.06
57 0.1
58 0.11
59 0.12
60 0.15
61 0.16
62 0.2
63 0.22
64 0.25
65 0.26
66 0.29
67 0.27
68 0.31
69 0.31
70 0.31
71 0.3
72 0.29
73 0.29
74 0.27
75 0.28
76 0.23
77 0.24
78 0.24
79 0.3
80 0.31
81 0.35
82 0.37
83 0.38
84 0.46
85 0.44
86 0.38
87 0.34
88 0.3
89 0.24
90 0.21
91 0.21
92 0.13
93 0.13
94 0.14
95 0.15
96 0.15
97 0.13
98 0.13
99 0.11
100 0.12
101 0.12
102 0.12
103 0.11
104 0.11
105 0.1
106 0.09
107 0.08
108 0.08
109 0.07
110 0.06
111 0.05
112 0.05
113 0.06
114 0.07
115 0.08
116 0.12
117 0.12
118 0.15
119 0.16
120 0.21
121 0.24
122 0.25
123 0.26
124 0.25
125 0.25
126 0.24
127 0.22
128 0.17
129 0.14
130 0.13
131 0.1
132 0.08
133 0.07
134 0.05
135 0.05
136 0.05
137 0.04
138 0.03
139 0.05
140 0.05
141 0.07
142 0.08
143 0.08
144 0.09
145 0.13
146 0.14
147 0.13
148 0.14
149 0.12
150 0.12
151 0.12
152 0.13
153 0.09
154 0.08
155 0.09
156 0.09
157 0.08
158 0.08
159 0.08
160 0.07
161 0.06
162 0.06
163 0.05
164 0.05
165 0.05
166 0.06
167 0.07
168 0.09
169 0.11
170 0.13
171 0.16
172 0.23
173 0.3
174 0.39
175 0.46
176 0.48
177 0.48
178 0.5
179 0.48
180 0.44
181 0.38
182 0.3
183 0.26
184 0.22
185 0.2
186 0.17
187 0.15
188 0.13
189 0.11
190 0.11
191 0.08
192 0.1
193 0.12
194 0.14
195 0.18
196 0.24
197 0.31
198 0.39
199 0.49
200 0.59
201 0.65
202 0.73
203 0.78
204 0.81
205 0.85
206 0.83
207 0.83
208 0.81
209 0.81
210 0.82
211 0.78
212 0.69
213 0.59
214 0.59
215 0.53
216 0.53
217 0.46
218 0.39
219 0.34
220 0.36
221 0.37
222 0.31
223 0.27
224 0.19
225 0.17
226 0.15
227 0.15
228 0.11
229 0.09
230 0.07
231 0.07
232 0.07
233 0.07
234 0.06
235 0.08
236 0.18