Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2PBC4

Protein Details
Accession A0A2T2PBC4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-32CTAPAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
11-26GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12.5, cyto_nucl 10, mito 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGCTAPAATGGKKQKKKWSKGKVKDKAQHAVVLDKTTSDKLQKDVQSYRLITVATLVDRLKINGSLARRALADLEEKGLIKKVVGHSKCSIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.8
4 0.83
5 0.84
6 0.86
7 0.89
8 0.93
9 0.92
10 0.92
11 0.89
12 0.85
13 0.81
14 0.71
15 0.64
16 0.54
17 0.49
18 0.39
19 0.34
20 0.27
21 0.2
22 0.19
23 0.17
24 0.17
25 0.16
26 0.16
27 0.17
28 0.24
29 0.25
30 0.29
31 0.3
32 0.32
33 0.34
34 0.33
35 0.31
36 0.25
37 0.22
38 0.17
39 0.16
40 0.12
41 0.08
42 0.09
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.09
49 0.1
50 0.12
51 0.14
52 0.16
53 0.17
54 0.17
55 0.17
56 0.16
57 0.16
58 0.14
59 0.15
60 0.11
61 0.13
62 0.13
63 0.13
64 0.13
65 0.15
66 0.14
67 0.11
68 0.16
69 0.21
70 0.3
71 0.32
72 0.37
73 0.38
74 0.43
75 0.48
76 0.46
77 0.41
78 0.34
79 0.36
80 0.33