Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NRU2

Protein Details
Accession A0A2T2NRU2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-124RTAIKARAKSKKKASADKKKRRKYRALEEGKEVEBasic
NLS Segment(s)
PositionSequence
94-115IKARAKSKKKASADKKKRRKYR
Subcellular Location(s) nucl 13.5, mito_nucl 11.166, cyto_nucl 10.833, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences RAFSASGVVLEKPLPPRRVILDEEIEENFLKGSGPGGQKINKTSSAVQLKHLPTGIVVKCQETRSRTQNRKLARRLLSERIEEFELGDQSRTAIKARAKSKKKASADKKKRRKYRALEEGKEVEEGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.33
4 0.37
5 0.41
6 0.41
7 0.38
8 0.36
9 0.35
10 0.35
11 0.33
12 0.29
13 0.24
14 0.21
15 0.15
16 0.1
17 0.08
18 0.06
19 0.07
20 0.11
21 0.13
22 0.15
23 0.19
24 0.23
25 0.25
26 0.28
27 0.3
28 0.27
29 0.28
30 0.27
31 0.31
32 0.36
33 0.34
34 0.34
35 0.38
36 0.36
37 0.35
38 0.34
39 0.25
40 0.17
41 0.23
42 0.21
43 0.18
44 0.18
45 0.18
46 0.2
47 0.22
48 0.25
49 0.22
50 0.26
51 0.31
52 0.4
53 0.45
54 0.51
55 0.55
56 0.59
57 0.65
58 0.66
59 0.66
60 0.61
61 0.61
62 0.58
63 0.61
64 0.57
65 0.5
66 0.45
67 0.39
68 0.35
69 0.28
70 0.23
71 0.18
72 0.15
73 0.13
74 0.12
75 0.1
76 0.09
77 0.11
78 0.11
79 0.1
80 0.14
81 0.18
82 0.25
83 0.35
84 0.45
85 0.51
86 0.59
87 0.68
88 0.72
89 0.77
90 0.8
91 0.82
92 0.83
93 0.88
94 0.9
95 0.91
96 0.92
97 0.94
98 0.92
99 0.92
100 0.91
101 0.91
102 0.9
103 0.9
104 0.84
105 0.82
106 0.76
107 0.67
108 0.57