Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2N149

Protein Details
Accession A0A2T2N149    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
231-264LECCRNPREHHPSIYKKYQKKKYKKAARLVRRKIBasic
NLS Segment(s)
PositionSequence
246-264KKYQKKKYKKAARLVRRKI
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039361  Cyclin  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR046965  Cyclin_A/B-like  
IPR004367  Cyclin_C-dom  
IPR006671  Cyclin_N  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0051301  P:cell division  
GO:0044772  P:mitotic cell cycle phase transition  
GO:0051726  P:regulation of cell cycle  
Pfam View protein in Pfam  
PF02984  Cyclin_C  
PF00134  Cyclin_N  
PROSITE View protein in PROSITE  
PS00292  CYCLINS  
Amino Acid Sequences EDGYDEDEDVMMAGEYIEDIFQYMRDRETNLGRMLYAEDQPDDRWSRRRALMDWLTCAHGSLKLLPETLYLAVNYLDRYLSKNRDMRDEELGCVGMTALFIAAKYEEEYVIPLEDLMKLSSDPPEESQVLSQEELMLRSLDYDLGWPCPVSFLRRNSKADDYDREVRNLAKYLLEVTIMEKRFVRCVSSFRAAGAYCLARLLLERGDWTPLHVYYSGYTMIQLDQMVLMILECCRNPREHHPSIYKKYQKKKYKKAARLVRRKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.1
10 0.11
11 0.14
12 0.16
13 0.18
14 0.22
15 0.28
16 0.32
17 0.31
18 0.31
19 0.28
20 0.27
21 0.28
22 0.26
23 0.22
24 0.18
25 0.17
26 0.18
27 0.19
28 0.23
29 0.25
30 0.26
31 0.32
32 0.34
33 0.39
34 0.43
35 0.47
36 0.43
37 0.48
38 0.54
39 0.49
40 0.49
41 0.44
42 0.4
43 0.36
44 0.34
45 0.25
46 0.18
47 0.16
48 0.16
49 0.18
50 0.16
51 0.17
52 0.17
53 0.16
54 0.16
55 0.16
56 0.13
57 0.09
58 0.09
59 0.09
60 0.1
61 0.09
62 0.08
63 0.08
64 0.07
65 0.11
66 0.17
67 0.21
68 0.27
69 0.31
70 0.32
71 0.39
72 0.43
73 0.42
74 0.44
75 0.41
76 0.35
77 0.32
78 0.31
79 0.22
80 0.18
81 0.15
82 0.07
83 0.05
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.06
99 0.05
100 0.05
101 0.05
102 0.06
103 0.05
104 0.05
105 0.05
106 0.06
107 0.08
108 0.08
109 0.09
110 0.09
111 0.12
112 0.12
113 0.12
114 0.13
115 0.13
116 0.13
117 0.12
118 0.11
119 0.08
120 0.08
121 0.08
122 0.08
123 0.06
124 0.05
125 0.06
126 0.06
127 0.05
128 0.05
129 0.06
130 0.06
131 0.07
132 0.08
133 0.07
134 0.07
135 0.09
136 0.09
137 0.13
138 0.18
139 0.25
140 0.33
141 0.39
142 0.42
143 0.44
144 0.48
145 0.48
146 0.47
147 0.45
148 0.43
149 0.45
150 0.44
151 0.41
152 0.37
153 0.33
154 0.31
155 0.27
156 0.21
157 0.14
158 0.13
159 0.13
160 0.12
161 0.11
162 0.09
163 0.1
164 0.16
165 0.16
166 0.17
167 0.18
168 0.18
169 0.22
170 0.22
171 0.23
172 0.19
173 0.22
174 0.28
175 0.3
176 0.3
177 0.26
178 0.29
179 0.26
180 0.24
181 0.24
182 0.18
183 0.13
184 0.13
185 0.12
186 0.08
187 0.09
188 0.1
189 0.08
190 0.08
191 0.1
192 0.11
193 0.14
194 0.14
195 0.15
196 0.16
197 0.16
198 0.17
199 0.16
200 0.17
201 0.14
202 0.17
203 0.15
204 0.12
205 0.12
206 0.11
207 0.11
208 0.11
209 0.1
210 0.08
211 0.07
212 0.07
213 0.07
214 0.06
215 0.05
216 0.05
217 0.06
218 0.07
219 0.08
220 0.11
221 0.13
222 0.16
223 0.22
224 0.32
225 0.41
226 0.45
227 0.54
228 0.61
229 0.7
230 0.75
231 0.81
232 0.8
233 0.8
234 0.84
235 0.86
236 0.86
237 0.87
238 0.9
239 0.91
240 0.92
241 0.93
242 0.93
243 0.93
244 0.94