Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2PD89

Protein Details
Accession A0A2T2PD89    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-37ADKIVKPPKHRLTCDNCKKSKVRCNQKRPECSRCLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDADKIVKPPKHRLTCDNCKKSKVRCNQKRPECSRCLRQGVECIYGLSHRAGRPRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.81
4 0.81
5 0.74
6 0.71
7 0.72
8 0.72
9 0.71
10 0.7
11 0.71
12 0.72
13 0.79
14 0.83
15 0.86
16 0.88
17 0.86
18 0.83
19 0.79
20 0.75
21 0.73
22 0.7
23 0.66
24 0.58
25 0.53
26 0.52
27 0.48
28 0.45
29 0.37
30 0.29
31 0.24
32 0.22
33 0.22
34 0.18
35 0.18
36 0.18
37 0.25