Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2N2Z2

Protein Details
Accession A0A2T2N2Z2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
152-209AKTFHTTPRKPCPPNRPARPRKSVPRHNGDKPMNEDRVCKRNKPRPLSPQNTNKAREPHydrophilic
NLS Segment(s)
PositionSequence
164-178PPNRPARPRKSVPRH
Subcellular Location(s) mito 14, nucl 9, cyto 3
Family & Domain DBs
Amino Acid Sequences MPMGARARERAGRERIRTQFRQISWAEAAVNPFFAFTYLHAPSSLPLGEDLCIAVAIDIWGDMRWTARACVPGGYPICGCAHAGLAPRHPPTNPTTSPTRSCASASSIRFACASAIPRIPPNAPATPNGTLHPDGQTGQPDKTDDCRRRPTAKTFHTTPRKPCPPNRPARPRKSVPRHNGDKPMNEDRVCKRNKPRPLSPQNTNKAREPSPSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.73
4 0.72
5 0.73
6 0.71
7 0.63
8 0.63
9 0.55
10 0.51
11 0.43
12 0.4
13 0.32
14 0.26
15 0.27
16 0.2
17 0.2
18 0.14
19 0.12
20 0.11
21 0.1
22 0.09
23 0.08
24 0.14
25 0.15
26 0.16
27 0.16
28 0.16
29 0.15
30 0.18
31 0.16
32 0.1
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.05
51 0.06
52 0.07
53 0.09
54 0.1
55 0.13
56 0.13
57 0.15
58 0.14
59 0.19
60 0.19
61 0.19
62 0.17
63 0.16
64 0.16
65 0.15
66 0.14
67 0.09
68 0.09
69 0.09
70 0.13
71 0.13
72 0.15
73 0.19
74 0.2
75 0.21
76 0.2
77 0.21
78 0.2
79 0.27
80 0.25
81 0.24
82 0.29
83 0.31
84 0.34
85 0.35
86 0.32
87 0.26
88 0.25
89 0.23
90 0.22
91 0.24
92 0.23
93 0.23
94 0.22
95 0.22
96 0.21
97 0.2
98 0.16
99 0.12
100 0.13
101 0.12
102 0.13
103 0.13
104 0.14
105 0.15
106 0.15
107 0.16
108 0.18
109 0.19
110 0.19
111 0.2
112 0.23
113 0.24
114 0.25
115 0.23
116 0.22
117 0.2
118 0.2
119 0.19
120 0.16
121 0.14
122 0.15
123 0.19
124 0.18
125 0.17
126 0.17
127 0.17
128 0.18
129 0.24
130 0.33
131 0.34
132 0.4
133 0.48
134 0.53
135 0.59
136 0.63
137 0.65
138 0.66
139 0.67
140 0.66
141 0.63
142 0.67
143 0.71
144 0.71
145 0.7
146 0.7
147 0.72
148 0.73
149 0.76
150 0.77
151 0.77
152 0.81
153 0.84
154 0.85
155 0.86
156 0.89
157 0.89
158 0.87
159 0.88
160 0.88
161 0.88
162 0.86
163 0.86
164 0.85
165 0.83
166 0.84
167 0.79
168 0.75
169 0.72
170 0.7
171 0.66
172 0.59
173 0.58
174 0.55
175 0.59
176 0.57
177 0.59
178 0.61
179 0.64
180 0.73
181 0.75
182 0.79
183 0.8
184 0.86
185 0.86
186 0.85
187 0.86
188 0.86
189 0.86
190 0.8
191 0.76
192 0.72
193 0.66